Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29230-AT2G34180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CBL-interacting protein kinase 18
Function (paralog2):CBL-interacting protein kinase 13

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.4541370658847
Log2 mRNA fold difference:2.2730344553147
Log2 TE fold difference:0.22164915612811
Sequences
Protein sequence

MAQALAQPPLVVTTVVPDPPPPPPPPHPKPYALRYMADLLGRIGIMDTDKDGNISPQSPR
SPRSPRNNILMGKYELGKLLGHGTFAKVYLAQNIKSGDKVAIKVIDKEKIMKSGLVAHIK
REISILRRVRHPYIVHLFEVMATKSKIYFVMEYVGGGELFNTVAKGRLPEETARRYFQQL
ISSVSFCHGRGVYHRDLKPENLLLDNKGNLKVSDFGLSAVAEQLRQDGLCHTFCGTPAYI
APEVLTRKGYDAAKADVWSCGVILFVLMAGHIPFYDKNIMVMYKKIYKGEFRCPRWFSSD
LVRLLTRLLDTNPDTRITIPEIMKNRWFKKGFKHVKFYIEDDKLCREDEDEEEEASSSGR
SSTVSESDAEFDVKRMGIGSMPRPSSLNAFDIISFSSGFDLSGLFEEEGGEGTRFVSGAP
VSKIISKLEEIAKIVSFTVRKKEWSLRLEGCREGAKGPLTIAAEIFELTPSLVVVEVKKK
GGDREEYEEFCNKELRPELEKLIHEEVVVEEALYLPSDTE

MAQVLSTPLAIPGPTPIQFMAGLLARIVTKNTNKETSTPESPRSPRTPQGSILMDKYEIG
KLLGHGSFAKVYLARNIHSGEDVAIKVIDKEKIVKSGLAGHIKREISILRRVRHPYIVHL
LEVMATKTKIYIVMEYVRGGELYNTVARGRLREGTARRYFQQLISSVAFCHSRGVYHRDL
KLENLLLDDKGNVKVSDFGLSVVSEQLKQEGICQTFCGTPAYLAPEVLTRKGYEGAKADI
WSCGVILFVLMAGYLPFDDKNILVMYTKIYKGQFKCPKWFSPELARLVTRMLDTNPDTRI
TIPEIMKHRWFKKGFKHVKFYIENDKLCREDDDNDDDDSSSLSSGRSSTASEGDAEFDIK
RVDSMPRPASLNAFDILSFSDLSGLFEEGGQGARFVSAAPMTKIISKLEEIAKEVKFMVR
KKDWSVRLEGCREGAKGPLTIRVEIFELTPSLVVVEVKKKGGNIEEYEEFCNKELRPQLE
KLMHYQADEVEEVMCLPPEIEQ

www.000webhost.com

Other information
Ka divergence:0.390156KaKs divergence:0.863913
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1563Length 2 (bp):1509Length divergence:-0.018
MFE 1 (kcal):-494.98MFE 2 (kcal):-465.63MFE divergence-0.031