Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29240-AT2G34170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF688)
Function (paralog2):Protein of unknown function (DUF688)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.28710494790815
Log2 mRNA fold difference:-0.085173746121922
Log2 TE fold difference:0.50876611352001
Sequences
Protein sequence

MEERKLNFSVPLLSTRRMQKTAGVSVRRNKSNNFTDYDSKTSECPSVPVLVPYMMGLDDE
VTEPASVPFTWEQAPGRLKGNDFKPQVCVLMKEEEQVFTPCLPPGKAVDANMTRLQSSKG
KQVEESDDDEDDVFSDALDTLSPKDSFSFNNSISGVSEYGGVETKKPLDAQSRDFMMSRF
LPAAKAMTVEQSHYASNRKPSTFMAEPTIQIRELVPGEKQQTPNRYDVSIVPSYYYHQDI
DDEESKVGEEDDEVSEYAYLSKRGCGMLPQLCFKDSLGMLNTVPGFKAKHNSPITSPSHD
QVKSSKVAQLKYRFQSVKKLALDSVSKHKLSGKVHSPVHPSNGKKFNSESNLISAAKRSS
SPYRHSRCMSPFRSTGNGSPLHHAGFPETRRETENLRANRLSNHTRNISRTSQELLYPKS
NGSILEKTVYVDTENDHMTNDQHNSNLMIFPEEADMTGRKPDANPELEAFENISIRSSEM
VKGNELVEISSGFDRSPLAPPSPKRPSESWLCHNLPSVTSQITSRRYHPFNPQKQDLTEN
YRNGTKWETIVKTSYMHRDHIRYSEELVAHTSHQSKT

MAEKQLNFDAPLLSTRRMKKSAISVRRNMPKQLTDESKTSESLSVSVLVQDMGLDQVPDS
PLESKHVEEEAEESEDDDVFSDALDTLSLKQSISGGGGVEAMKPSMPSEDPQFMLDRFLP
AAKSLTLEQPPQYSWKRQPLPLMSEPMRQIRDIVPAENRATPTRYESSFTPSYYQDIDDE
ESEEDSDDDEVSEYLSKRGCGMMSPQICFKNSLGMLSSVNGLKEKPYSLRTPSHDQVKSS
KVAQLKSRFQSVKKLALDYKQKLGSIAQSPVHPSVGKKFNFGSEQHESKSSASRPSSPYR
QNGCMSPYRSVGNSSPLHAAGFPGTRKEAEVMRANRLNKHIRNISKSHESLYPKSTKQDC
STSSAMEKTLYVDSENSPRTSNENRSSNVKKLPETISEEPEMEGKKPKAVRELKAVETLS
ISSGVKMMKADELGKNNSGCDLSPLAPPPPKKPSESWLFSNLPSVSSKIPSPRYLFHPQK
KNVEENSTSVTKWETIVKTSYTHRDHIRYSEELVAHSSCQSKT

Other information
Ka divergence:-0.180497KaKs divergence:-0.011583
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1734Length 2 (bp):1572Length divergence:-0.049
MFE 1 (kcal):-483.37MFE 2 (kcal):-450.56MFE divergence-0.035