Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29250-AT2G34160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Alba DNA/RNA-binding protein
Function (paralog2):Alba DNA/RNA-binding protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.13220521667551
Log2 mRNA fold difference:-1.7094759599353
Log2 TE fold difference:1.5530150194123
Sequences
Protein sequence

MEEITEGVNNMNLAVDTQKKNRIQVSNTKKPLFFYVNLAKRYMQQYTDVELSALGMAIAT
VVTVAEILKNNGFAVEKKIMTSTVDIKDDSRGRPVQKAKIEITLAKSEKFDELMAAANEE
KEAAEAQEQN

MEEITDGVNNMNLATDSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMAIAT
VVTVTEILKNNGFAVEKKIMTSTVDIKDDARGRPVQKAKIEITLVKSEKFDELMAAANEE
KEDAEAQVQN

Other information
Ka divergence:0.547359KaKs divergence:0.237537
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):393Length 2 (bp):393Length divergence:0
MFE 1 (kcal):-107.3MFE 2 (kcal):-105MFE divergence-0.011