Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29310-AT2G34250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SecY protein transport family protein
Function (paralog2):SecY protein transport family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.3343106568961
Log2 mRNA fold difference:2.1320809880174
Log2 TE fold difference:0.20067054716739
Sequences
Protein sequence

MGGGFRVLHLVRPFLAFLPEVQSADRKIPFREKVIYTVISLFIFLVCSQLPLYGIHSTTG
ADPFYWMRVILASNRGTVMELGITPIVTSGLVMQLLAGSKIIEVDNNVREDRALLNGAQK
LLGILIAIGEAVAYVLSGMYGPVGQLGVGNAILIILQLFFAGIIVICLDELLQKGYGLGS
GISLFIATNICESIIWKAFSPTTINTGRGAEFEGAVIALFHMLITKSNKVAALRQAFYRQ
NLPNVTNLLATVLIFLIVIYFQGFRVVLPVRSKSARGQQGSYPIKLFYTSNMPIILQSAL
VSNLYFISQLLYRKFSGNFFVNLLGQWKESEYSGQSIPVSGLAYLITAPASFADMAAHPF
HALFYIVFMLTACALFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPT
AAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKEKASELGFFGF

MGGGFRVLHLVRPFLAFLPEVQSADRKVPFREKVIYTVISLFIFLVCSQLPLYGIHSTTG
ADPFYWMRVILASNRGTVMELGITPIVTSGLVMQLLAGSKIIEVDNNVREDRALLNGAQK
LLGILIAIGEAVAYVLSGMYGPVGQLGVGNAILIILQLFFAGIIVICLDELLQKGYGLGS
GISLFIATNICESIIWKAFSPTTINTGRGAEFEGAVIALFHMLITKSNKVAALRQAFYRQ
NLPNVTNLLATVLIFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILQSAL
VSNLYFISQLLYRKFSGNFFVNLLGQWKESEYSGQSIPVSGLAYLITAPASFSDMAAHPF
HALFYIVFMLTACALFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPT
AAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKEKASELGFFGF

www.000webhost.com

Other information
Ka divergence:-0.338558KaKs divergence:-0.524752
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1428Length 2 (bp):1428Length divergence:0
MFE 1 (kcal):-450.23MFE 2 (kcal):-447.16MFE divergence-0.003