Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29350-AT1G29370
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Kinase-related protein of unknown function (DUF1296)
Function (paralog2):Kinase-related protein of unknown function (DUF1296)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.0006929639515329
Log2 mRNA fold difference:-0.0004162665738159
Log2 TE fold difference:0.022439929089737
Sequences
Protein sequence

MSSSKVGGGARKGIQDIPSGSRKIVQSLTEIVNSPEAEIYAMLKECNMDPNETVSRLLSQ
DPFHEVKSKKEKKKETRDISDSRPRGANNTYNRGARGGSARYAGRSGSTHFSSTDSGNFQ
GKSTNKKESGTQGYTSSWSSASGVANTYQTPHSEPIAMENKLPPVTLGDGISSSKSASGH
QTAWFGAPGQRSMAEVVKMGRPQNKTTKQNVNVGSEINHEHEVNANQQAPVKDEWPSIEK
PLAPSTSSLSVAPAESEVRNGLADFQSDRGDQYLKDRLENIHIAESGPSESRGVDHVQAD
SVQEDESVVSSEIDDNPYQTQSHPVEHHKDEDDVSSGSASFQQLDSHDQEVSHEEDRPAV
VIPNHLLIHTEECAQLSFGSFGGFGSRPLSNSVEATSDVAPQIEHSDARNTEFYGDEHLG
STTNGNMVHTPATGNYDDSLETRREVLKQENSEGAQEHQYTFTQSEQGYAYENAKQQQMN
SAYDASHTNSQNQMHNLDSLSNVMQGYSHSVPNTLLAQTAQNARELDFQYSPFSAQQSMQ
SRTSNNASSLGGQSISMPEALRGSGIPATQPTQQTLPGANIATGPALPQQLPMHYSQPTL
PLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLPQYKTNVSPGNLPQSAT
APASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYEDVLSSQYKENHLLALQQQQQQQQH
QQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQQQQAQQAAGGYRQAQQQ
QHYGSHGYPNYYQSQTEMSLERQQQNPRDGAGSQAGQPSNQSQQQLWQNSY

MSSSKVGGGARKGIQDIPSGSRKIVQSLTEIVNSPEAEIYAMLKECNMDPNETVSRLLSQ
DPFHEVKSKKEKKKETRDISDSRPRGANNTYNRGARGGSARYAGRSGSTHFSSTDSGNFQ
GKSTNKKESGTQGYTSSWSSASGVANTYQTPHSEPVATENKLPPVTLGDGISSSQSASGH
QTAWFGAPGQRSMAEVVKMGRPQNKTTKQNVNMGSEINHEHKVSANHQAPVKDEWPSIEK
PLAPSTSSLSVAPAESEVRNGPADFQSDRGDQYLKDRLENIHIAESGPSESRKVDHVQAD
SVQEDESVVSSEIDDNPYQTQSHPVEHHKDEDDVSSGSASFQQLDSHDQEVSHEKDRPAV
VIPNHLLIHTEECAQLSFGSFGGFGSRPLSNSVEATSDVAPQIEHSDARNTEFYGDEHLG
STTNGNMVHTPATGNYDDSLETRREVLKQENSEGAQEHQYTFTQSEQGYAYENAKQQQMN
SAYDASHTNSQNQMHNLDSLSNVMQGYSHSVPNTLLAQTAQNARELDFQYSPFSAQQSMQ
SRTSNNASSLGGQSISMPEALRGSGIPATQPTQQTLPGANIATGPALPQQLPMHYSQPTL
PLTHYANMIGYPLMPQNYPYMPSAFQQTFAGNSAYHQQLAALLPQYKTNVSPGNLPQSAT
APASAYGFGNSTNVGSAGNFPLNQQSATTGTTLGYDDVLSSQYKENHLLALQQQQQQQQH
QQQNENSAMWHQGHGSRTMSGVPTNTYYNLQAQQQLQLQHQQQQQQAQQAAGGYRQAQQQ
QHYGSHGYPNYYQSQTEMSLERQQQNPRDGAGSQAGQPSNQSQQQLWQNSY

www.000webhost.com

Other information
Ka divergence:0.140752KaKs divergence:0.915092
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2496Length 2 (bp):2496Length divergence:0
MFE 1 (kcal):-728.74MFE 2 (kcal):-723.2MFE divergence-0.004