Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29390-AT1G29395
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cold regulated 314 thylakoid membrane 2
Function (paralog2):COLD REGULATED 314 INNER MEMBRANE 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-3.1117675972237
Log2 mRNA fold difference:-3.1135381407937
Log2 TE fold difference:0.020156912803713
Sequences
Protein sequence

MASLCLSSSRIVSLHHQKPFLALKLRPRPSNISGLGHSTSVVCFNPLRLSADRQRTATVS
ARAEKRRKRGSSVVCYATPMLSVHNLQWISTISCVALMFARGTGIHKSFVVPLFALQAPM
GIVSWMKGEYGIWAAFLALLTRLFFSFPVELELPFIALLLVIVAPYQVMSIRGKQEGAIL
SLAISCFLAFQHFSRAGTLQKAFDQNSVLATVAIIGVTVVSFLFLI

MASLCLSSSRIVSLHHQKPFLSLKLRSRPSDLSGLGRHTSPVCFNPLRLSGDRQRTATVS
TRVEKRRKRGSSVVCYAAPISANSLQWISTISCLALMLARGTGIHKSVVVPLFALHAPSS
IVAWIKGEYGVWAAFLALIARLFFTFPGELELPFIALLLVIVAPYQVMNIRGKQEGAIIA
IAISGFLAFQHFSRAGSLEKAYEKGSVLATVAIIGVTVVSLLLLL

www.000webhost.com

Other information
Ka divergence:0.29414KaKs divergence:0.21998
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):681Length 2 (bp):678Length divergence:-0.002
MFE 1 (kcal):-212.22MFE 2 (kcal):-211.9MFE divergence-0.001