Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29470-AT2G34300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Function (paralog2):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.7123655614916
Log2 mRNA fold difference:-1.791134901085
Log2 TE fold difference:0.11356003273691
Sequences
Protein sequence

MAMGKYSRVDGKKSSGYGLTITIVLIVSLCLVGAWMFMSSWSAPTESIDFSANERTKDVD
TTKSDFKSEEVDRGSKSFPDEKNEETEVVTETNEEKTDPEKSGEENSGEKTESAEERKEF
DDKNGDGDRKNGDGEKDTESESDETKQKEKTQLEESSEENKSEDSNGTEENAGESEENTE
KKSEENAGETEESTEKSKDVFPAGDQAEITKESSTGSGAWSTQLVESQNEKKAQVSSIKW
KVCNVTAGPDYIPCLDNWQAIRKLHSTKHYEHRERHCPEESPRCLVSLPEGYKRSIKWPK
SREKIWYTNIPHTKLAEVKGHQNWVKMSGEYLTFPGGGTQFKNGALHYIDFLQESYPDIA
WGNRTRVILDVGCGVASFGGYLFDRDVLALSFAPKDEHEAQVQFALERGIPAMSNVMGTK
RLPFPGSVFDLIHCARCRVPWHIEGGKLLLELNRALRPGGFFVWSATPVYRKTEEDVGIW
KAMSKLTKAMCWELMTIKKDELNEVGAAIYQKPMSNKCYNERSQNEPPLCKDSDDQNAAW
NVPLEACIHKVTEDSSKRGAVWPESWPERVETVPQWLDSQEGVYGKPAQEDFTADHERWK
TIVSKSYLNGMGIDWSYVRNVMDMRAVYGGFAAALKDLKLWVMNVVPIDSPDTLPIIYER
GLFGIYHDWCESFSTYPRTYDLLHADHLFSSLKKRCNLVGVMAEVDRILRPQGTFIVRDD
METIGEIEKMVKSMKWNVRMTHSKDGEGLLSVQKSWWRPTEAETIQSAIA

MAMGKYSRVDGKKSSSYGLTITIVLLLSLCLVGTWMFMSSWSAPADSAGYSSTDTAKDVS
KNDLRKEEGDRDPKNFSDEKNEENEAATENNQVKTDSENSAEGNQVNESSGEKTEAGEER
KESDDNNGDGDGEKEKNVKEVGSESDETTQKEKTQLEESTEENKSEDGNGNEEKAEENAS
ETEESTEKSSKEVFPAGDQAEITKESSTGDGAWSTQLVESQNEKKAQQSSISKDQSSYGW
KTCNVTAGPDYIPCLDNWQAIKKLHTTMHYEHRERHCPEESPHCLVSLPDGYKRSIKWPK
SREKIWYNNVPHTKLAEIKGHQNWVKMSGEHLTFPGGGTQFKNGALHYIDFIQQSHPAIA
WGNRTRVILDVGCGVASFGGYLFERDVLALSFAPKDEHEAQVQFALERGIPAMLNVMGTK
RLPFPGSVFDLIHCARCRVPWHIEGGKLLLELNRALRPGGFFVWSATPVYRKNEEDSGIW
KAMSELTKAMCWKLVTIKKDKLNEVGAAIYQKPTSNKCYNKRPQNEPPLCKDSDDQNAAW
NVPLEACMHKVTEDSSKRGAVWPNMWPERVETAPEWLDSQEGVYGKPAPEDFTADQEKWK
TIVSKAYLNDMGIDWSNVRNVMDMRAVYGGFAAALKDLKLWVMNVVPVDAPDTLPIIYER
GLFGIYHDWCESFNTYPRTYDLLHADHLFSTLRKRCNLVSVMAEIDRILRPQGTFIIRDD
METLGEVEKMVKSMKWKVKMTQSKDNEGLLSIEKSWWRPEETETIKSAIA

www.000webhost.com

Other information
Ka divergence:0.498261KaKs divergence:0.68045
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2313Length 2 (bp):2313Length divergence:0
MFE 1 (kcal):-701.06MFE 2 (kcal):-698.47MFE divergence-0.002