Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29640-AT2G34340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF584
Function (paralog2):Protein of unknown function, DUF584

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.9326299982892
Log2 mRNA fold difference:0.36779464778359
Log2 TE fold difference:-1.4587099454883
Sequences
Protein sequence

MSEEFDESEIIFSDNYFPIRRREDGNEKENNRPVDFRENSERVWNKSSRRSKTTPLPSAV
TAFSSSLPVNIPMRRYSTEEEYSDDDGGRKMIPPHLIVGRRMEGGQMAFSVCTGNGRTLK
GRDLSRVRNSVLKLTGFLEA

MAEEFDESEVVFSDGLSSVLHKENENRLFGSDMERKKTRRIKRTTTEKASLSSSLPVSIP
ENIFRRYVGKEEDEYSEEEYSEGGGEMIPPHIMIGRRIQGGQMAFSVCSGSGRTLKGRDL
SRVRNSVLRLTGFLEA

www.000webhost.com

Other information
Ka divergence:-0.270387KaKs divergence:-0.993966
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):423Length 2 (bp):411Length divergence:-0.014
MFE 1 (kcal):-136.3MFE 2 (kcal):-143.2MFE divergence0.025