Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29660-AT1G29670
Species:Arabidopsis
Duplication type:TD
Function (paralog1):GDSL-like Lipase/Acylhydrolase superfamily protein
Function (paralog2):GDSL-like Lipase/Acylhydrolase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.20766472511571
Log2 mRNA fold difference:-0.13676421318832
Log2 TE fold difference:-0.057489481759925
Sequences
Protein sequence

MESYLRKWCLVSVWVLLLGLGFKVKAEPQVPCYFIFGDSLVDNGNNNRLRSIARADYFPY
GIDFGGPTGRFSNGRTTVDVLTELLGFDNYIPAYSTVSGQEILQGVNYASAAAGIREETG
AQLGQRITFSGQVENYKNTVAQVVEILGDEYTAADYLKRCIYSVGMGSNDYLNNYFMPQF
YSTSRQYTPEQYADDLISRYRDQLNALYNYGARKFALVGIGAIGCSPNALAQGSQDGTTC
VERINSANRIFNNRLISMVQQLNNAHSDASFTYINAYGAFQDIIANPSAYGFTNTNTACC
GIGRNGGQLTCLPGEPPCLNRDEYVFWDAFHPSAAANTAIAKRSYNAQRSSDVYPIDISQ
LAQL

MESYLTKWCVVLVLLCFGFSVVKAQAQAQVPCFFVFGDSLVDNGNNNGLISIARSNYFPY
GIDFGGPTGRFSNGKTTVDVIAELLGFNGYIPAYNTVSGRQILSGVNYASAAAGIREETG
RQLGQRISFSGQVRNYQTTVSQVVQLLGDETRAADYLKRCIYSVGLGSNDYLNNYFMPTF
YSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALSGIGAVGCSPNALAGSPDGRTCV
DRINSANQIFNNKLRSLVDQLNNNHPDAKFIYINAYGIFQDMITNPARFGFRVTNAGCCG
IGRNAGQITCLPGQRPCRDRNAYVFWDAFHPTEAANVIIARRSYNAQSASDAYPMDISRL
AQL

Other information
Ka divergence:-0.192913KaKs divergence:-0.572444
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1095Length 2 (bp):1092Length divergence:-0.001
MFE 1 (kcal):-311.69MFE 2 (kcal):-323.11MFE divergence0.018