Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29760-AT2G34380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Putative adipose-regulatory protein (Seipin)
Function (paralog2):Putative adipose-regulatory protein (Seipin)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.1470171585041
Log2 mRNA fold difference:-1.7429150463211
Log2 TE fold difference:0.46813058725804
Sequences
Protein sequence

MDSESESESNPSTTDEFDRFLDAPDEFYYDCLPIRSNSHQPSSLLRRRKSAHRRDLISSD
IETEPSSSSDGFDVGEKSSYVEKNAELRGDIDTSDVIESTKDSIDLSSEKENDLDVISSS
GNDMDVIDSGRNRVDPFQEESTVTTVSSDDQGDDDYAGSVPQFREPPNSTEWSLLGFLVG
LVIKAIEFQVSFMTSLLTFPPWLLRNCFLFFFDPFSTIRFGRRFLMARVAGISDMIFGYM
NPFRLKDTKQMLSIVCKFGWGMFWAVYVGIVLFGLLVSSLMIGGYVINRIADKPFEVKET
LNFDYTKNSPEAYVPISSCAGVECEGSCKESNEMSKIRGLRVIPRDQKLDIILSMTLPES
AYNKNLGMFQVRVDFLSVDGQTIASIRRPCMLRFRSEPIRLVQTFFKVVPLVTGYVSEIQ
TLSLKLKGFVEKDIPTACLKIIIEQRAEFRPGAGIPELYDASLSVESGLPFFRKIIWKWR
KTLFVWISMSLFITELLFTLVCCRPLIIPRTQPRDRSPSNPTGVWR

MESESESSSTHSSCDRFLDAEDEFFYDSFSNHYDCLNSSPPANLRRRRLPMDTDSSSSSS
TSSLESCEKRSTVGENDELEVSLVDFETIEIDVDVTDSANSSIDSISEKGEDFEVIDSCT
DTEKNMGENDSGRVDPFTVTTLNDERGEIYTGPEYTSTDWSLTSLVIRSIEFQVSLMITF
IRFPPWLISKCLSFVFDPYRTMRRGRRYLVSWIVGLCDSGLKDDKPVLELVRRVTWGLFC
AVYVGIMLFALLVSAFMISGFVITYLAHEPLVIKESLNFDYTKSSPEAYVPISSCAGVAF
GLSGKESIETGKVKGLKDRTEITVSMTLPESEYNRNLGMFQVRVDFLSASGHVLASSRRP
CMVKFSSEPIRLVQTLLKIAPLVTGYVSEIQTLNLKLKGLVEKDIIPTACLKIMIEQRAE
FRPGAGIPEIYDASLFLESKLPFLKRIIWNWRKTLFVWISMSLFIMELLFALVFFRPLII
PRTGQRTQQRDGTHSINNNLYLDGQAGSR

Other information
Ka divergence:-0.101769KaKs divergence:-0.624701
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1581Length 2 (bp):1530Length divergence:-0.016
MFE 1 (kcal):-466MFE 2 (kcal):-463.11MFE divergence-0.003