Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29820-AT1G29830
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Magnesium transporter CorA-like family protein
Function (paralog2):Magnesium transporter CorA-like family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.3046106701279
Log2 mRNA fold difference:-3.1541167734899
Log2 TE fold difference:1.1210062398586
Sequences
Protein sequence

MGENGENHSVSQESKSKKLESKNHSGVPKSDLWTDGIICAFEFIRGPKKHVDSKQLEKGA
LKQEDGPISHSFPGHNPFVDSSPVDDLRSRSVSSLDFKEAHLLPSGHVERYEGSHWVPIG
WARITELVQMVQVNAEWPNLELIDDEEDVPVTDLAAPYWERPGGPTWWCHLSAGNSFVEG
WLRSATWLHPAISLALRDESKLISERMRHLLYEVPVRVAGGLLFELLGQSVGDPVISEDD
VPVVFRSWQAKNFLVSVMHIKGNVTNTNVLGITEVEELLYAGGYNVPRTVHEVIAHLACR
LSRWDDRLFRKSIFGAADEIELKFMNRRNYEDLNLFSIILNQEIRKLSRQVIRVKWSLHA
REEIIFELLQHLRGNIARHLLDGLRKNTREMLEEQEAVRGRLFTIQDVMQSSVRAWLQDK
SLRVSHNLAVFGGCGLVLTIIVGLFGINVDGIPGAQNTPYAFGLFTFLMVLLGAILIVVG
LVYLGLKKPITEEQVEVRKLELQDVVKIFQHEAETHAQLRRNNLSPTAGDVFDADYILIQ

MISSFHNLQLVVWYELCKLLGIFHRYYLVSRAMNRQDPAITTNHVSQESKNHSGVPKSDL
WTDGIICAFEFIRGPKKHVDSKQLYKGYLKQEDGPIRHSFPGHNPFIDSPAVDYLRSRSV
SSLDFKEAHVLPSGHVERSEGSHWVPIGWTRITKLVQQVQVNAEWPNLKLIDDEEDVPVT
DLAAPYWERPGGPTWWCHLTAGNSFVEGWLRSATWLHPAISLALRDESKLISERMRHLLY
EVPVRVDGGLLFELLGQSMGDPVIGEDDVPVVFRSWQAKNFLVSVMHIKGNVSKSNVLGI
TEVEELLYAGSYNVPRTIHEVIAHLACRLSRWDDRLFRKSIFGAADEIELKFMNRRNHED
LNLFSIILNQEIRKLARQTIRVKWSLHAREEIILELLQHLRGNIPRHLLEGLRNNTREML
EEQEAVRGRLFTIQDNIQSNIRSWLQDQSLNGSHNLAIFGGCGLVLTIILGLFSVNLDGV
PGVKHTPYAFVLFSVFLVLIGIVLIAFGLRYLGPKKPITEEHVEARKLELQNVVKIFQHE
AETHAQLRRNNLSPTAGDVFDADYFLIQ

www.000webhost.com

Other information
Ka divergence:0.498803KaKs divergence:0.153424
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1623Length 2 (bp):1707Length divergence:0.025
MFE 1 (kcal):-492.71MFE 2 (kcal):-537.02MFE divergence0.043