Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29870-AT1G29880
Species:Arabidopsis
Duplication type:TD
Function (paralog1):tRNA synthetase class II (G, H, P and S) family protein
Function (paralog2):glycyl-tRNA synthetase / glycine--tRNA ligase

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.6508028443575
Log2 mRNA fold difference:3.7689560833897
Log2 TE fold difference:-0.0063205147913553
Sequences
Protein sequence

MDAPEQSFLREKSLAVEDQELAVGTLEDSHAAKPETNAAIELPNKSKPEKSAVEKDREDF
REAVVKTLDRLLFVHKSFDIYHGVAGLYDFGPHGRTVELNILSLWRKCFVDEEDMMEVAC
TALTPEAVFNASGHVKKFTDLMVKDEVDGAFHRADHLVKSYCENRKKDPTISAENAAELD
KVIAHVEDLSAEELGGVWNHCSTAPVTKNPLSHPPRPFNLMFQTSFGASGSLIGYLRPET
AQGSFCNFKDYYNLNGRKLPFAVAQVGRVFRNEISPRQGLLRTREFTLAEIEHFVHPEHK
SHSKFSDVAKLELLMFPREEQEKPGQFAKRLCLGEAVAKGHVNSETLGFFIGRVYLFLIR
LGIDKERLRFRHHLANEMAHYATDCWDAEIECSYGWIECVGIADRSDYDLRAHSEKSGHA
LVAQEKLAEPIEVEKLAITPEMKELGPAFKGNQKNVVEALEVD

MRIFSTFVFHRRQQIFNLRQFQTTTILRNPISIAPIQIPMDATEQSLRQSLSEKSSSVEA
QGNAVRALKASRAAKPEIDAAIEQLNKLKLEKSTVEKELQSIISSSGNGSLNREAFRKAV
VNTLERRLFYIPSFKIYSGVAGLFDYGPPGCAIKSNVLSFWRQHFILEENMLEVDCPCVT
PEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAEKAAELKDVL
AVMEDFSPEQLGAKIREYGITAPDTKNPLSDPYPFNLMFQTSIGPSGLIPGYMRPETAQG
IFVNFKDLYYYNGKKLPFAAAQIGQAFRNEISPRQGLLRVREFTLAEIEHFVDPENKSHP
KFSDVAKLEFLMFPREEQMSGQSAKKLCLGEAVAKGTVNNETLGYFIGRVYLFLTRLGID
KERLRFRQHLANEMAHYAADCWDAEIESSYGWIECVGIADRSAYDLRAHSDKSGTPLVAE
EKFAEPKEVEKLVITPVKKELGLAFKGNQKNVVESLEAMNEEEAMEMKATLESKGEVEFY
VCTLKKSVNIKKNMVSISKEKKKEHQRVFTPSVIEPSFGIGRIIYCLYEHCFSTRPSKAG
DEQLNLFRFPPLVAPIKCTVFPLVQNQQFEEVAKVISKELASVGISHKIDITGTSIGKRY
ARTDELGVPFAITVDSDTSVTIRERDSKDQVRVTLKEAASVVSSVSEGKMTWQDVWATFP
HHSSAAADE

Other information
Ka divergence:-0.814172KaKs divergence:-0.118723
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1392Length 2 (bp):2190Length divergence:0.223
MFE 1 (kcal):-441.95MFE 2 (kcal):-668.49MFE divergence0.204