Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29890-AT2G34410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-acetyltransferase family protein
Function (paralog2):O-acetyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.2658326834859
Log2 mRNA fold difference:-1.1687048201183
Log2 TE fold difference:0.94455928235266
Sequences
Protein sequence

MDPVDMVVSQPITPGQVSFLLGVIPLMIAWLYSEFLEYRRSSFHAKVHSDKNLVELEMVT
NKEDEGTVLMEGGLPRSASSKFYSSPIKTNLIRFLTLEDSFLLENRATLRAMAEFGAILL
YFYICDRTSLIGQSQKNYSRDLFLFLFCLLIIVSAMTSLKKHTDKSPITGKSILYLNRHQ
TEEWKGWMQVLFLMYHYFAAVEFYNAIRVFIAGYVWMTGFGNFSYYYIRKDFSLARFTQV
RSTIFDHHSLFSLPCDVLLESTMSFKAQDFYESFYLIQMMWRLNFFVAFCCIILNNDYML
YYICPMHTLFTLMVYGALGIYSQYNEIASVMALKIASCFLVVILMWEIPGVFEIFWSPLA
FLLGYTDPAKPDLPRLHEWHFRSGLDRYIWIIGMIYAYFHPTVERWMEKLEECDAKRRMS
IKTSIIGISSFAGYLWYEYIYKLDKVTYNKYHPYTSWIPITVYICLRNCTQQLRRFSLTL
FAWLGKITLETYISQFHIWLRSSVPNGQPKLLLSIIPEYPMLNFMLTTAIYVLVSVRLFE
LTNTLKSVFIPTKDDKRLLHNVIAMAAISFCLYIIGLILLLIPH

MADSQPITPGQVSFLLGVIPVFIAWIYSEFLEYKRSSLHSKVHSDNNLVELGEVKNKEDE
GVVLLEGGLPRSVSTKFYNSPIKTNLIRFLTLEDSFLIENRATLRAMAEFGAILFYFYIS
DRTSLLGESKKNYNRDLFLFLYCLLIIVSAMTSLKKHNDKSPITGKSILYLNRHQTEEWK
GWMQVLFLMYHYFAAAEIYNAIRVFIAAYVWMTGFGNFSYYYIRKDFSLARFTQMMWRLN
LFVAFSCIILNNDYMLYYICPMHTLFTLMVYGALGIFSRYNEIPSVMALKIASCFLVVIV
MWEIPGVFEIFWSPLTFLLGYTDPAKPELPLLHEWHFRSGLDRYIWIIGMIYAYFHPTVE
RWMEKLEECDAKRKMSIKTSIIAISSFVGYLWYEYIYKLDKVTYNKYHPYTSWIPITVYI
CLRNSTQQLRNFSMTLFAWLGKITLETYISQFHIWLRSNVPNGQPKWLLCIIPEYPMLNF
MLVTAIYVLVSHRLFELTNTLKSVFIPTKDDKRLLHNVLAGAAISFCLYLTSLILLQIPH

www.000webhost.com

Other information
Ka divergence:-0.336425KaKs divergence:-0.299604
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):1755Length 2 (bp):1623Length divergence:-0.039
MFE 1 (kcal):-474.8MFE 2 (kcal):-428.96MFE divergence-0.051