Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G29980-AT2G34510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF642
Function (paralog2):Protein of unknown function, DUF642

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.97616988178668
Log2 mRNA fold difference:2.3852178081564
Log2 TE fold difference:-1.3103846582966
Sequences
Protein sequence

MVPSNNRCKWSSIFLFLLSVSVAVLVAVADDKSPAVEDGLVINGDFETSPSSGFPDDGVT
DGPSDIPSWKSNGTVELINSGQKQGGMILIVPQGRHAVRLGNDAEISQDLTVEKGFVYSV
TFSAARTCAQLESINVSVASVNADADDMLASRNVDLQTLYSVQGWDPYAWAFEAEDDHVR
LVFKNPGMEDDPTCGPIIDDIAIKKLFTPDKPKDNAVINGDFEDGPWMFRNTSLGVLLPT
NLDEEISSLPGWTVESNRAVRFVDSDHFSVPKGKRAVELLSGKEGIISQMVETKADKPYI
LSFSLGHAGDKCKEPLAIMAFAGDQAQNFHYMAQANSSFEKAGLNFTAKADRTRVAFYSV
YYNTRTDDMSSLCGPVIDDVRVWFSGSKRIGAGFGFWVFVLLVVGLV

MMLYSNNSWRSNSILILLLGLSIVAAADSAGKTSPVEDGLVVNGDFETPPSNGFPDDAII
EDTSEIPSWRSDGTVELIKSGQKQGGMILIVPEGRHAVRLGNDAEISQELTVEKGSIYSV
TFSAARTCAQLESLNVSVASSDEPIASQTIDLQTVYSVQGWDPYAWAFEAVVDRVRLVFK
NPGMEDDPTCGPIIDDIAVKKLFTPDKPKGNAVINGDFEEGPWMFRNTTLGVLLPTNLDE
EISSLPGWTVESNRAVRFIDSDHFSVPEGKRALELLSGKEGIISQMVETKANIPYKMSFS
LGHAGDKCKEPLAVMAFAGDQAQNFHYMAQANSSFERSELNFTAKAERTRIAFYSIYYNT
RTDDMTSLCGPVIDDVKVWFSGSSRIGFSFPLFILLSLVFI

Other information
Ka divergence:-0.0143165KaKs divergence:-0.676497
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1224Length 2 (bp):1206Length divergence:-0.007
MFE 1 (kcal):-410.02MFE 2 (kcal):-395.15MFE divergence-0.018