Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30120-AT2G34590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):pyruvate dehydrogenase E1 beta
Function (paralog2):Transketolase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.033852661089047
Log2 mRNA fold difference:0.48213415030228
Log2 TE fold difference:-0.57964752115038
Sequences
Protein sequence

MSSIIHGAGAATTTLSTFNSVDSKKLFVAPSRTNLSVRSQRYIVAGSDASKKSFGSGLRV
RHSQKLIPNAVATKEADTSASTGHELLLFEALQEGLEEEMDRDPHVCVMGEDVGHYGGSY
KVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNC
GMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLM
KAAIRSENPVILFEHVLLYNLKEKIPDEDYVCNLEEAEMVRPGEHITILTYSRMRYHVMQ
AAKTLVNKGYDPEVIDIRSLKPFDLHTIGNSVKKTHRVLIVEECMRTGGIGASLTAAINE
NFHDYLDAPVMCLSSQDVPTPYAGTLEEWTVVQPAQIVTAVEQLCQ

MSAILQGAGAATALSPFNSIDSNKLVAPSRSSLSVRSKRYIVAGSDSKSFGSSLVARRSE
PLIPNAVTTKADTAASSTSSKPGHELLLFEALQEGLEEEMDRDPHVCVMGEDVGHYGGSY
KVTKGLADKFGDLRVLDTPICENAFTGMGIGAAMTGLRPVIEGMNMGFLLLAFNQISNNC
GMLHYTSGGQFTIPVVIRGPGGVGRQLGAEHSQRLESYFQSIPGIQMVACSTPYNAKGLM
KAAIRSENPVILFEHVLLYNLKESIPDEEYICNLEEAEMVRPGEHITILTYSRMRYHVMQ
AAKTLVNKGYDPEVIDIRSLKPFDLYTIGNSVKKTHRVLIVEECMRTGGIGASLTAAINE
NFHDYLDAPVMCLSSQDVPTPYAGTLEEWTVVQPAQIVTAVEQLCQ

Other information
Ka divergence:-0.322183KaKs divergence:-0.266949
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1221Length 2 (bp):1221Length divergence:0
MFE 1 (kcal):-404.11MFE 2 (kcal):-396.92MFE divergence-0.009