Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30135-AT2G34600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):jasmonate-zim-domain protein 8
Function (paralog2):jasmonate-zim-domain protein 7

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.9291577481877
Log2 mRNA fold difference:1.1940240177581
Log2 TE fold difference:0.47455156892287
Sequences
Protein sequence

MKLQQNCDLELRLFPTSYDSDSSDTTSVVESTSSGNPQPNEESQRITIFYNGKMCFSSDV
THLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKASMKKSLQSFLQKRKIR
IQATSPYHSRR

MIIIIKNCDKPLLNFKEMEMQTKCDLELRLLTSSYDSDFHSSLDESSSSEISQPKQESQI
LTIFYNGHMCVSSDLTHLEANAILSLASRDVEEKSLSLRSSDGSDPPTIPNNSTRFHYQK
ASMKRSLHSFLQKRSLRIQATSPYHRYR

www.000webhost.com

Other information
Ka divergence:-0.0537244KaKs divergence:0.999754
GC content 1 (%):37GC content 2 (%):40GC content divergence:0.039
Length 1 (bp):396Length 2 (bp):447Length divergence:0.06
MFE 1 (kcal):-80MFE 2 (kcal):-97.01MFE divergence0.096