Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30400-AT2G34660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):multidrug resistance-associated protein 1
Function (paralog2):multidrug resistance-associated protein 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.69753994910893
Log2 mRNA fold difference:-1.2127221345752
Log2 TE fold difference:0.46399657251975
Sequences
Protein sequence

MGFEPLDWYCKPVPNGVWTKTVDYAFGAYTPCAIDSFVLGISHLVLLILCLYRLWLITKD
HKVDKFCLRSKWFSYFLALLAAYATAEPLFRLVMRISVLDLDGAGFPPYEAFMLVLEAFA
WGSALVMTVVETKTYIHELRWYVRFAVIYALVGDMVLLNLVLSVKEYYGSFKLYLYISEV
AVQVAFGTLLFVYFPNLDPYPGYTPVGTENSEDYEYEELPGGENICPERHANLFDSIFFS
WLNPLMTLGSKRPLTEKDVWHLDTWDKTETLMRSFQKSWDKELEKPKPWLLRALNNSLGG
RFWWGGFWKIGNDCSQFVGPLLLNELLKSMQLNEPAWIGYIYAISIFVGVVLGVLCEAQY
FQNVMRVGYRLRSALIAAVFRKSLRLTNEGRKKFQTGKITNLMTTDAESLQQICQSLHTM
WSAPFRIIVALVLLYQQLGVASIIGALFLVLMFPIQTVIISKTQKLTKEGLQRTDKRIGL
MNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKAQLLSAFNMFILNSIPVLVTVVS
FGVFSLLGGDLTPARAFTSLSLFSVLRFPLFMLPNIITQMVNANVSLNRLEEVLSTEERV
LLPNPPIEPGQPAISIRNGYFSWDSKADRPTLSNINLDIPLGSLVAVVGSTGEGKTSLIS
AMLGELPARSDATVTLRGSVAYVPQVSWIFNATVRDNILFGAPFDQEKYERVIDVTALQH
DLELLPGGDLTEIGERGVNISGGQKQRVSMARAVYSNSDVCILDDPLSALDAHVGQQVFE
KCIKRELGQTTRVLVTNQLHFLSQVDKILLVHEGTVKEEGTYEELCHSGPLFQRLMENAG
KVEDYSEENGEAEVDQTSVKPVENGNANNLQKDGIETKNSKEGNSVLVKREERETGVVSW
KVLERYQNALGGAWVVMMLVICYVLTQVFRVSSSTWLSEWTDSGTPKTHGPLFYNIVYAL
LSFGQVSVTLINSYWLIMSSLYAAKKMHDAMLGSILRAPMVFFQTNPLGRIINRFAKDMG
DIDRTVAVFVNMFMGSIAQLLSTVILIGIVSTLSLWAIMPLLVVFYGAYLYYQNTSREIK
RMDSTTRSPVYAQFGEALNGLSSIRAYKAYDRMAEINGRSMDNNIRFTLVNMAANRWLGI
RLEVLGGLMVWLTASLAVMQNGKAANQQAYASTMGLLLSYALSITSSLTAVLRLASLAEN
SLNSVERVGNYIEIPSEAPLVIENNRPPPGWPSSGSIKFEDVVLRYRPELPPVLHGVSFL
ISPMDKVGIVGRTGAGKSSLLNALFRIVELEKGRILIDECDIGRFGLMDLRKVLGIIPQA
PVLFSGTVRFNLDPFSEHNDADLWESLERAHLKDTIRRNPLGLDAEVTEAGENFSVGQRQ
LLSLARALLRRSKILVLDEATAAVDVRTDVLIQKTIREEFKSCTMLIIAHRLNTIIDCDK
VLVLDSGKVQEFSSPENLLSNGESSFSKMVQSTGTANAEYLRSITLENKRTREANGDDSQ
PLEGQRKWQASSRWAAAAQFALAVSLTSSHNDLQSLEIEDDNSILKKTKDAVVTLRSVLE
GKHDKEIEDSLNQSDISRERWWPSLYKMVEGLAVMSRLARNRMQHPDYNLEGKSFDWDNV
EM

MGFEFIEWYCKPVPNGVWTKQVANAFGAYTPCATDSFVLGISQLVLLVLCLYRIWLALKD
HKVERFCLRSRLYNYFLALLAAYATAEPLFRLIMGISVLDFDGPGLPPFEAFGLGVKAFA
WGAVMVMILMETKIYIRELRWYVRFAVIYALVGDMVLLNLVLSVKEYYSSYVLYLYTSEV
GAQVLFGILLFMHLPNLDTYPGYMPVRSETVDDYEYEEISDGQQICPEKHANIFDKIFFS
WMNPLMTLGSKRPLTEKDVWYLDTWDQTETLFTSFQHSWDKELQKPQPWLLRALNNSLGG
RFWWGGFWKIGNDCSQFVGPLLLNQLLKSMQEDAPAWMGYIYAFSIFVGVVFGVLCEAQY
FQNVMRVGYRLRSALIAAVFRKSLRLTNEGRRKFQTGKITNLMTTDAESLQQICQSLHTM
WSAPFRIIIALILLYQQLGVASLIGALLLVLMFPLQTVIISKMQKLTKEGLQRTDKRIGL
MNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKSQLLGALNMFILNSIPVLVTIVS
FGVFTLLGGDLTPARAFTSLSLFAVLRFPLFMLPNIITQVVNANVSLKRLEEVLATEERI
LLPNPPIEPGEPAISIRNGYFSWDSKGDRPTLSNINLDVPLGSLVAVVGSTGEGKTSLIS
AILGELPATSDAIVTLRGSVAYVPQVSWIFNATVRDNILFGSPFDREKYERAIDVTSLKH
DLELLPGGDLTEIGERGVNISGGQKQRVSMARAVYSNSDVYIFDDPLSALDAHVGQQVFE
KCIKRELGQKTRVLVTNQLHFLSQVDRIVLVHEGTVKEEGTYEELSSNGPLFQRLMENAG
KVEEYSEENGEAEADQTAEQPVANGNTNGLQMDGSDDKKSKEGNKKGGKSVLIKQEERET
GVVSWRVLKRYQDALGGAWVVMMLLLCYVLTEVFRVTSSTWLSEWTDAGTPKSHGPLFYN
LIYALLSFGQVLVTLTNSYWLIMSSLYAAKKLHDNMLHSILRAPMSFFHTNPLGRIINRF
AKDLGDIDRTVAVFVNMFMGQVSQLLSTVVLIGIVSTLSLWAIMPLLVLFYGAYLYYQNT
AREVKRMDSISRSPVYAQFGEALNGLSTIRAYKAYDRMADINGRSMDNNIRFTLVNMGAN
RWLGIRLETLGGLMIWLTASFAVMQNGRAENQQAFASTMGLLLSYALNITSLLTGVLRLA
SLAENSLNAVERVGNYIEIPPEAPPVIENNRPPPGWPSSGSIKFEDVVLRYRPQLPPVLH
GVSFFIHPTDKVGIVGRTGAGKSSLLNALFRIVEVEKGRILIDDCDVGKFGLMDLRKVLG
IIPQSPVLFSGTVRFNLDPFGEHNDADLWESLERAHLKDTIRRNPLGLDAEVSEAGENFS
VGQRQLLSLSRALLRRSKILVLDEATAAVDVRTDALIQKTIREEFKSCTMLIIAHRLNTI
IDCDKILVLDSGRVQEFSSPENLLSNEGSSFSKMVQSTGAANAEYLRSLVLDNKRAKDDS
HHLQGQRKWLASSRWAAAAQFALAASLTSSHNDLQSLEIEDDSSILKRTNDAVVTLRSVL
EGKHDKEIAESLEEHNISREGWLSSLYRMVEGLAVMSRLARNRMQQPDYNFEGNTFDWDN
VEM

www.000webhost.com

Other information
Ka divergence:-0.18846KaKs divergence:0.00559832
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):4869Length 2 (bp):4872Length divergence:0
MFE 1 (kcal):-1485.36MFE 2 (kcal):-1512.19MFE divergence0.009