Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30500-AT2G34720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nuclear factor Y, subunit A7
Function (paralog2):nuclear factor Y, subunit A4

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.331210092474
Log2 mRNA fold difference:1.9515097655141
Log2 TE fold difference:0.2675845717834
Sequences
Protein sequence

MTSSIHELSDNIGSHEKQEQRDSHFQPPIPSARNYESIVTSLVYSDPGTTNSMAPGQYPY
PDPYYRSIFAPPPQPYTGVHLQLMGVQQQGVPLPSDAVEEPVFVNAKQYHGILRRRQSRA
RLESQNKVIKSRKPYLHESRHLHAIRRPRGCGGRFLNAKKEDEHHEDSSHEEKSNLSAGK
SAMAASSGTS

MTSSVHELSDNNESHAKKERPDSQTRPQVPSGRSSESIDTNSVYSEPMAHGLYPYPDPYY
RSVFAQQAYLPHPYPGVQLQLMGMQQPGVPLQCDAVEEPVFVNAKQYHGILRRRQSRAKL
EARNRAIKAKKPYMHESRHLHAIRRPRGCGGRFLNAKKENGDHKEEEEATSDENTSEASS
SLRSEKLAMATSGPNGRS

www.000webhost.com

Other information
Ka divergence:0.490739KaKs divergence:0.484096
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):573Length 2 (bp):597Length divergence:0.021
MFE 1 (kcal):-151.11MFE 2 (kcal):-168.74MFE divergence0.055