Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30590-AT2G34750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA polymerase I specific transcription initiation factor RRN3 protein
Function (paralog2):RNA polymerase I specific transcription initiation factor RRN3 protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5008963203246
Log2 mRNA fold difference:2.8764579637967
Log2 TE fold difference:-1.3467464210278
Sequences
Protein sequence

MGAEEFPSVPFNSNAMDNAEYTDTDLVFAVRKALASVQNGDTDDYSQLKTVMCLTEDADF
DAVAQLETVLKSLSVSVAWIDLVHHKDLLEAMSLWYHSHRPSVMDALVDLIISLAATSGK
YLDPCLNMLVRNFSQPTFKHKVSQTQLVKKMQEVHPRVHAALHKISYLIPLAPWNLVSIL
AQNMRKIDKKDPSIVTYVDNLLRLENSSIGEVVGSVILMMVMERMLDLDLVSGCDDSNGG
MFDMELEDAVESTMNEGDEFPVGALKQNTSGGNVVSELLDKLMVLFFHHLESCQNSDRLD
EVFEILFKSFENYILNTYKTKFSQFLMFYACSLDPENCGVRFASKLLDIYLSSNTCRLTR
MSAVAYLASYLSRGKFLPASFVASMLKRLVDECAEYCGTCNDDVKPEAHQVFYSGCQAIL
YVLCFRMRSIVEIPRFQSQFRSLESILSHKLNPLLVCLPSVVSEFLKQAKAGGLFIVSES
FIFDDLHESELSRAFGGFERLDTFFPFDPCLLKMSSSYISPNFNFWSMVKTTYGEDGDEE
LCDEVIVNGDADSAEEPDDDVELDSEMNTMSTTPKHSFMRETERLLKMPSRIRPSTSPPE
SFLI

MGAVELMSDPSSLCTVENYVDNVDLSDTQLVQTVRKALTSVKTGDSDLYSEMVGVMARDI
KEFKDPDVVAQLETVLKALSGAVACIDVLHHQKLLSALFRMKLWDHRPDVMDALVNLVIS
LAVTSGKYLDSCLNMLVSNFVPPPWVVNNLSHSRILNKKIDVLSRVHAALLKISILVPLT
PSRLVPMLFQQMPKMHKKDHSIVIYVESLLKLENSSIGQVGGSMILGMVMERLRDLDLEI
EWDDIPQDDSSRGMFDMELEDAAEGTMNDGDELPVGPLKQDTSDGSIVSKLLDKLMVVAF
EHLESCQNDGRLDQVFESLFKSFENFILNTYKSKFTQFLIFYACSLDPENCGVKFASKLV
EIFLSSNKHVATRMSAVAYLASFLARGKFLPVSFVASMLKRLIDECVGYCRTCNDDTRPE
AHQIFFSGCQAIMYVLCFRMRSILDVPRFRSQLTPLESILMHKLNPLMVCLPSVVAEFLR
QAKEGGLFIVSDSFIFDDLLESELSRAFGGFERLDTFFPFDPCLLKSSNSFISPNFIYWS
MVKATYDEDDDDNDAEVIVNGDEDSDEDDEADLDYALNKMSITPKHSFKNKMERDRLLRM
PSRIRPSTSPESL

Other information
Ka divergence:0.0710901KaKs divergence:-0.30587
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1815Length 2 (bp):1842Length divergence:0.007
MFE 1 (kcal):-517.61MFE 2 (kcal):-570.43MFE divergence0.049