Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30630-AT2G34840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Coatomer epsilon subunit
Function (paralog2):Coatomer epsilon subunit

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.9113300838719
Log2 mRNA fold difference:-3.3466905777318
Log2 TE fold difference:0.44546978988562
Sequences
Protein sequence

MASMAGPDHLFNLRNHFYLGAYQAAINNSEIPNLSQEDIVERDCLVHRAYIALGSYQLVI
SEIDEAAATPLQAVKLLAMYLSSPENKESTISSLREWLADPTVGNNAIIRLIAGTIFMHE
EDYNEALKHTHSGGTMDLHALNVQIFIKMHRSDFAEKQLRVMQQIDEDHTLTQLASAWLN
LAVGGSKIQEAYLIFQDFSEKYPMTSLILNGKAVCCMHMGNFEEAETLLLEALNKDAKDP
ETLANLVVCSLHVGKSSSRYLNQLKLSHPEHVLVKRAASAEDNFERALQSFA

MSAMGAGPDHLFNLRNNFYLGAYQTAINNSEIANLSPENAVERDCLVFRSYIALGSYQLV
ISEIDESAATPLQAVKLLAMYLSTPQNKESTISSLKEWLADSTIGNNDTLRLIAGIIFMH
EEDYNETLKHTHAGGTMDLYALNVQIFIKMHRAEYAEKQLRVMQQIDEDHTLTQLASAWL
NLAVGGSKIQEAYLIFEDFSEKYPMTCLILNGKAVCCMQMGNFDEAETLLLEALNKDAKD
PETLANLVVCSLHVGKSSSRHLSQLKLSHPEHILVKRVSSAEDNFERAVQLVA

Other information
Ka divergence:-0.0370976KaKs divergence:-0.216789
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):879Length 2 (bp):882Length divergence:0.002
MFE 1 (kcal):-254.04MFE 2 (kcal):-246.11MFE divergence-0.016