Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30650-AT2G34830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WRKY DNA-binding protein 14
Function (paralog2):WRKY DNA-binding protein 35

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.4612556085736
Log2 mRNA fold difference:-2.0180563807562
Log2 TE fold difference:0.58085198856907
Sequences
Protein sequence

MCSVSELLDMENFQGDLTDVVRGIGGHVLSPETPPSNIWPLPLSHPTPSPSDLNINPFGD
PFVSMDDPLLQELNSITNSGYFSTVGDNNNNIHNNNGFLVPKVFEEDHIKSQCSIFPRIR
ISHSNIIHDSSPCNSPAMSAHVVAAAAAASPRGIINVDTNSPRNCLLVDGTTFSSQIQIS
SPRNLGLKRRKSQAKKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPFPRGYY
RCSSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPIQRNALAGSTRSSTSSSSNPNPS
KPSTANVNSSSIGSQNTIYLPSSTTPPPTLSSSAIKDERGDDMELENVDDDDDNQIAPYR
PELHDHQHQPDDFFADLEELEGDSLSMLLSHGCGGDGKDKTTASDGISNFFGWSGDNNYN
NYDDQDSRSL

MDNFQGDLTDVVRGIGSGHVSPSPGPPEGPSPSSMSPPPTSDLHVEFPSAATSASCLANP
FGDPFVSMKDPLIHLPASYISGAGDNKSNKSFAIFPKIFEDDHIKSQCSVFPRIKISQSN
NIHDASTCNSPAITVSSAAVAASPWGMINVNTTNSPRNCLLVDNNNNTSSCSQVQISSSP
RNLGIKRRKSQAKKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRC
SSSKGCSARKQVERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTRSSSSSSLNPSSKSS
TAAATTSPSSRVFQNNSSKDEPNNSNLPSSSTHPPFDAAAIKEENVEERQEKMEFDYNDV
ENTYRPELLQEFQHQPEDFFADLDELEGDSLTMLLSHSSGGGNMENKTTIPDVFSDFFDD
DESSRSL

Other information
Ka divergence:0.0213641KaKs divergence:0.0816379
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1293Length 2 (bp):1284Length divergence:-0.003
MFE 1 (kcal):-374.19MFE 2 (kcal):-385.17MFE divergence0.014