Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30710-AT2G34810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):FAD-binding Berberine family protein
Function (paralog2):FAD-binding Berberine family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.5477419761441
Log2 mRNA fold difference:2.679234256469
Log2 TE fold difference:-1.7636519695905
Sequences
Protein sequence

MTSLTTQTLIITIFLLTIPTSFASPPSLEDVFAQCVTDFKPSNPKSPIQNYIYTQRSPNF
LTILNNYVRNLRYFNNMTRKPVAIVAAADVTHIQATITCAKKLGLQLRIRSGGHDYDGMS
YLSTIDFVVLDMFNLRSINIDPKLDTAWVQSGATLGEIYYGVANKSNDLRGFPAGICPGL
GAGGHFSGGGYGNMMRKYGLSIDNIIDAKIVDAKGRVLDRSSMGEDLFWALRGGGAASFC
VVLAWKIKLVPVPAKVTVFNIETFGNTGSVNTTELVAKWQEIADKIDNDLFIRLTLGSSN
KTVKASFMGMYLGNSSNLLEIMNAKFPELGLIKRECIEMKWIESVLFWLGIPPGTAPTTS
MLNRIPQKQIYLKRKSDYVQKPISRTGLESIFKIMTENENVTMAFNPYGGRMSEIPSTET
AFPHRAGNMFKIQYAANWFVPGEAVAKDCLSQTERLFEAMSPYVSKNPREAFLNYRDVDI
GKSLNSTYEEGKVYGFKYFKDNFEKLVKIKSRVDPDNFFRYEQSIPVLSSH

MKFWSRPLTFLIIIIYLIIQQVNSSPPSLSIPEHFLRCLDTQPSDHGSPNSRTAVIPTNS
SFSTNLMNGVRNLRFASVSTRKPEVIVAAVTETHIRATISCCKLLNLELRIRSGGHDYEG
FSYTSPVPFVILDMYNFNKIDINMKDETVWIQSGASLGQLYYNIASKSKVHAFPAGVCPK
VGAGGHFSGGGFGNLMRKYGLSIDHIIDAQIMDANGKVYRNRQAMGEDVFWAIRGGGGGS
YGVILAWKIKLVRVPEKVTVFKLERTVREGAVDLVHKWQQVAPVIDRDLFIRLEIKPINR
KISKGKTIKVSFIGMFLGLPERLLNITKQSFPELHLTKEDCMVKKWIESSVFWANYPEKA
PIELLLKRVSTNEYYWKRTSDFVQAPISKQGLAKIFQTMIDHSPLPRRVWMQWNPWGGKM
AEIASDATAFVHRGGNVFMIEHFMNWYRPGDELEEKFLAIARSFKEAMAPFVSKNPREAF
FNYRDVDIGITTPGYNATYEGAKVYGDSYFKGNYLRLVKIKARFDRTNFFRSQQGIPVLA

www.000webhost.com

Other information
Ka divergence:0.107635KaKs divergence:0.194863
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1596Length 2 (bp):1623Length divergence:0.008
MFE 1 (kcal):-455.23MFE 2 (kcal):-468.49MFE divergence0.014