Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30860-AT2G34920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.1043719574631
Log2 mRNA fold difference:-1.4982090898257
Log2 TE fold difference:-1.3345653341484
Sequences
Protein sequence

MVSSPQRFGLILRDRNQNAGVFQKNLKSPVKEVLKSHVSDENLVDSWIETHNNKNNRVLE
SPLESKRNDNLVASSLVQIWEARLNRSNGGNSPSSSQSTASSSSRSDSGVSVQDSGLSES
SSIDGDSEIADRTVEIESRSHGLVSDSGESKWGRVADLIRRLSNEDKKRTAGDNGSGGGG
GLEIIRTPRPYCTSSSSEKSNFPVVSFSPKIRGRQAFTDFLMQMERDRHRELDSLFERNA
VSRFTQRGRLQSMLRLRNLNRCLVIQDRNRSNAKTTGLNRIESGSAVLHLREKFHANVVN
SAAATDKRKNHQRSTEMNNKSVEETEGTTTTSTRLKDGGVTLEAFFAERLRPRNRKIEEA
TLCKEEESVSGTVDSQKNCLQLQETREVEETCNDGKSEKKEEENTSPSEYLSRESRLRQN
QDENNVGKYMQETRETEGLVHESNEMDQCLDQQETSYLNRWGEQEEYADEQSYYGEYNDD
WLSEIARPRSYWEELRKSRYLEVMNTRSEKDDICRLLERRTVTDFLDSGLREKIDNLMMS
RVQTHSDKHSKKWELQQEEEEEVNFEIDEEIKEEPLRGGEEQDDRDDLSQSSSSHISASS
PAGSWSSQDTDVTSTPALVVQNPQSPEMELISGMRSQIQQLQQEMSVLRDSVKTCLDANA
SLQHKAHQENPMKRKCCVCDETQVEAVLYRCGHMCMCLKCANELHWSGGKCPICRAQIVD
VVRVIYDTRN

MASLRPSFGSVLRDRNQRHNDDVVFKKNLKAQVKTAPPAISDESSENRVDSLIGNKRKKN
NKSRPGSPEKPRTRKGNNFSDNLGGASSLVQIWEARLNRSNGGNSAIHSQSIEISSEASV
QEIHLLAPSIDGESESENESKSPDQTVEIESGTLNSVSDIIRRLSNEQKLTASNNGGAVD
MPIVKTPTLEKSSFQVVTCSPRIRGRQAYSDLLVHLERERHRELESLLGRNAVSRFPQRG
RLQSMLRLRSLKRGLAIQDRHRGTTKSDLNRFQPSSTILHLREKLREKAANAAAEAGLKK
GQQSTVETESMQSKETSGILHSPSTERLSPQKRNIEEAILRKNETETKMSYLQLKKAIVA
EVLERESDNTSPLTSVTPQEPRILRNEEAGKLESGTEGTQETPFLETQEMSFQSGWEEQE
EYEDEQSYYGDMSYDWFTEISRPRTYWEDLRKSRYLEVMNTKSDKDDICRLLERRTVSGF
LQSGLREKIDKLIMSRVQIHPAHRIEEATKEEEKYDIGEEKDEDRDDLSQSSSQIFAPSP
AGSWSSLDTGVTSTPTHNLHSTLQLEMSELRDSVKTCLDVNASLQKSVHLENPFKRKCCV
CNETQVETLLYRCGHMCTCLRCANELQYNGGKCPICHAKILDVVRVFVDSRT

www.000webhost.com

Other information
Ka divergence:0.0671237KaKs divergence:0.107295
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):2193Length 2 (bp):1959Length divergence:-0.056
MFE 1 (kcal):-665.2MFE 2 (kcal):-598.96MFE divergence-0.052