Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G30900-AT2G34940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):VACUOLAR SORTING RECEPTOR 6
Function (paralog2):VACUOLAR SORTING RECEPTOR 5

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-4.0608609925473
Log2 mRNA fold difference:-2.9051688516199
Log2 TE fold difference:-1.1517457974869
Sequences
Protein sequence

MSLIHKGATLALFLALTMVVNGVFGRFIVEKSSVTILNPLAMRSKHDAAIANFGVPNYGG
YMIGSVVYAGQGAYGCDSFDKTFKPKFPRPTILIIDRGECYFALKVWNGQQSGVAAVLVA
DNVDEPLITMDSPEESKEADDFIEKLNIPSALIDFSFANTLKQALKKGEEVVLKIDWSES
LPHPDERVEYELWTNTNDECGARCDEQMNFVKNFKGHAQILEKGGYSLFTPHYITWFCPK
DYVSSNQCKSQCINQGRYCAPDPEQDFGDGYDGKDIVFENLRQLCVHKVAKENNRSWVWW
DYVTDFHIRCSMKEKKYSKECAERVVESLGLPLDKIKKCIGDPDANVENEVLKAEQALQV
GQGDRGDVTILPTLIVNNAQYRGKLERNAVLKAICSGFKERTEPGICLSGDIETNECLEA
NGGCWEDKKSNVTACKDTFRGRVCECPVVNGVQYKGDGYTSCEPYGPARCSINQGGCWSE
TKKGLTFSACSNLETSGCRCPPGFKGDGLKCEDIDECKEQSACQCDGCNCKNKWGGFECK
CSGNRLYMKEQDTCIERSGSRIGWFPTFVILAAVASICVGGYVFYKYRLRSYMDSEIMAI
MSQYMPLESQNTTDPMTGESQHQQLRLTSAA

MSPSNKGTVLALILALTMVVVNGFSSRFFVEKSSLTVLNSWEMGAKHDAAIANFGLPKYG
GFMIGSVVYAGQDAYGCNSFNKTFNTKSPYPKILLIDRGVCNFALKIWNGQQSGAAAVLL
ADNIVEPLITMDTPQDEDPDFIDKVKIPSALILRSFGDSLKKALKRGEEVILKMDWSESI
PNPDERVEYELWANTNDECGVHCDKQIDFIKNFKGMAQILEKGGYTLFRPHYISWVCPKE
LLLSKQCRTQCINQGRYCALDTKQEFEDGYNGKDVVYENLRQLCVHKVAKEKNTSWVWWD
YVTDFNIRCSMKEKKYSRECAETIVESLGLSLEKIKKCIGDPDADVENEVLKAEEAFQLG
QENRGIVTIFPTLMINNAQYRGKLERTAVLKAICSGFKERTEPSICLNSDIETNECLIEN
GGCWQDKRSNVTACKDTFRGRVCECPVVDGVQYKGDGYTSCKPYGPARCSMNNGDCWSET
RKGLTFSSCSDSETSGCRCPLGFLGDGLKCEDIDECKEKSACKCDGCKCKNNWGGYECKC
SNNSIYMKEEDTCIERRSGSRSRGLFTIVVLTAIAGISLGAYIFYKYHLQSYMDSEIVSI
MSQYIPLDSQSINQDSFK

www.000webhost.com

Other information
Ka divergence:0.290562KaKs divergence:0.716621
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1896Length 2 (bp):1857Length divergence:-0.01
MFE 1 (kcal):-556.91MFE 2 (kcal):-552.85MFE divergence-0.004