Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31020-AT2G35010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):thioredoxin O2
Function (paralog2):thioredoxin O1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1658487759838
Log2 mRNA fold difference:1.357253733244
Log2 TE fold difference:-0.214642190929
Sequences
Protein sequence

MKSQWSNFHQIGRNSFLAASTVYVSNEFNFLNTSLLNRRSFCFAEGDRSSFVVLKSEAEF
NSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDIDEGGLSNAIG
KLNVSAVPTLQFFKGGVKKAEIVGVDVVRLKSVMEQLYK

MKGNWSIVRKVLHRQFSTLRSSTPSSRLSTSIRPLVLAPNSISSLIARNSLFTASNIGPS
IDFNFSNTSLPHRRSLCSEAGGENGVVLVKSEEEFINAMSKAQDGSLPSVFYFTAAWCGP
CRFISPVIVELSKQYPDVTTYKVDIDEGGISNTISKLNITAVPTLHFFKGGSKKGEVVGA
DVTKLKNLMEQLYK

Other information
Ka divergence:-0.360118KaKs divergence:-0.999795
GC content 1 (%):41GC content 2 (%):46GC content divergence:0.057
Length 1 (bp):480Length 2 (bp):585Length divergence:0.099
MFE 1 (kcal):-131.62MFE 2 (kcal):-171.3MFE divergence0.131