Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31070-AT2G35020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):N-acetylglucosamine-1-phosphate uridylyltransferase 1
Function (paralog2):N-acetylglucosamine-1-phosphate uridylyltransferase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.86295155917422
Log2 mRNA fold difference:-0.77601159759357
Log2 TE fold difference:-0.16634008128717
Sequences
Protein sequence

MIEPSMERENGALTAATTTTTAVTSPPPMASSPRQALVERLKDYGQEDIFSLWDELSPDE
KDFLVRDIENLDLPRIDRIIRCSLHSQGLPVAAIEPVPENWVSTVDGRTMEDREKWWKMG
LKTIYEGKLGVVLLSGGQGTRLGSSDPKGCFNIGLPSGKSLFQIQAERILCVQRLAAQVV
SEGPIRPVTIHWYIMTSPFTDEATRKYFSSHKYFGLEPDQISFFQQGTLPCVTKDGKFIM
ETPFSLAKAPDGNGGVYAALKCSRLLEDMASRGIKYVDCYGVDNVLVRVADPTFLGYFID
KGAASAAKVVRKAYPQEQVGVFVRRGKGGPLTVVEYSELDQSMASAINQRTGRLQYCWSN
VCLHMFTLDFLNQVATGLEKDSVYHLAEKKIPSMNGYTMGLKLEQFIFDSFPYAPSTALF
EVLREEEFAPVKNVNGSNFDTPESARLLVLRLHTRWVIAAGGFLTHSVPLYATGVEVSPL
CSYAGENLEAICRGRTFHAPCEISL

MKEPTTEIEIETSAVATILPPPLPPTASPHQALVERLKDYGQEDVFSLWDELSPEERDLL
LRDIENLDLPRIDRIIRCSLHSQGLPVAAIEPVPENCVSTVEERTKEDREKWWKMGLKAI
YEGKLGVVLLSGGQGTRLGSSDPKGCYNIGLPSGKSLFQIQAERILCVQRLASQAMSEAS
PTRPVTIQWYIMTSPFTHEPTQKFFKSHKYFGLEPDQVTFFQQGTLPCISKDGKFIMETP
FSLSKAPDGNGGVYTALKSSRLLEDMASRGIKYVDCYGVDNVLVRVADPTFLGYFIDKSA
ASAAKVVRKAYPQEKVGVFVRRGKGGPLTVVEYTELDQSMASATNQQTGRLQYCWSNVCL
HMFTLDFLNQVANGLEKDSVYHLAEKKIPSINGDIVGLKLEQFIFDCFPYAPSTALFEVL
REEEFAPVKNANGSNYDTPESARLLVLRLHTRWVIAAGGFLTHSVPLYATGVEVSPLCSY
AGENLEAICRGRTFHAPCEISL

www.000webhost.com

Other information
Ka divergence:-0.0607046KaKs divergence:0.305665
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):1518Length 2 (bp):1509Length divergence:-0.003
MFE 1 (kcal):-445.8MFE 2 (kcal):-482.4MFE divergence0.039