Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31120-AT2G35060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):K+ uptake permease 10
Function (paralog2):K+ uptake permease 11

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1660788034659
Log2 mRNA fold difference:-1.8223369993744
Log2 TE fold difference:1.9396200025464
Sequences
Protein sequence

MAGRVESSIGGGEIDEEGDERGSMWDLDQSLDQPMDEEAGRLRNMYREKKFSAFLLLQLS
FQSLGVVYGDLGTSPLYVFYNTFPRGIKDPEDIIGALSLIIYSLTLIPLLKYVFVVCKAN
DNGQGGTFALYSLLCRHAKVSTIPNQHRTDEELTTYSRTTFHERSFAAKTKRWLENGTSR
KNALLILVLVGTCMVIGDGILTPAISVLSAAGGLRVNLPHINNGIVVVVAVVILVSLFSV
QHYGTDRVGWLFAPIVFLWFLFIASIGMFNIWKHDPSVLKAFSPVYIFRYFKRGGQDRWT
SLGGIMLSITGIEALFADLSHFPVSAVQFAFTVIVFPCLLLAYSGQAAYLRKYPHHVEDA
FYQSIPKRVYWPMFIIATAAAIVASQATISATFSLIKQALAHGCFPRVKVVHTSRKFLGQ
IYVPDINWILMILCIAVTAGFKNQNQIGNAYGTAVVIVMLVTTLLMMLIMILVWRCHWVL
VLLFTLLSLVVECTYFSAVLFKVNQGGWVPLVIAAAFLVIMYVWHYGTLKRYEFEMHSKV
SMAWILGLGPSLGLVRVPGIGLVYTELASGVPHIFSHFITNLPATHSVVIFVCVKNLPVY
TVPQEERFLVKRIGPKNFHMFRCVARYGYRDLHKKDDDFEKRLFESLFLFLRLESMMEGC
SDSEDYSVCGSQQRQSRDGVNGNGNEIRNVSTFDTFDSIESVIAPTTTKRTSHTVTGSSQ
MSGGGDEVEFINGCRDAGVVHIMGNTVVRARREARFYKRIAIDYVYAFLRKICRENSAIF
NVPQESLLNVGQIFYV

MAARVEAATMGGEIDEEESDERGSMWDLDQKLDQSMDEEAGRLRNMYREKKFSALLLLQL
SFQSLGVVYGDLGTSPLYVFYNTFPHGIKDPEDIIGALSLIIYSLTLIPLLKYVFVVCKA
NDNGQGSGTFALYSLLCRHAKVKTIQNQHRTDEELTTYSRTTFHEHSFAAKTKRWLEKRT
SRKTALLILVLVGTCMVIGDGILTPAISVLSAAGGLRVNLPHISNGVVVFVAVVILVSLF
SVQHYGTDRVGWLFAPIVFLWFLSIASIGMYNIWKHDTSVLKAFSPVYIYRYFKRGGRDR
WTSLGGIMLSITGIEALFADLSHFPVSAVQIAFTVIVFPCLLLAYSGQAAYIRRYPDHVA
DAFYRSIPGSVYWPMFIIATAAAIVASQATISATFSLVKQALAHGCFPRVKVVHTSRKFL
GQIYVPDINWILMILCIAVTAGFKNQSQIGNAYGTAVVIVMLVTTLLMTLIMILVWRCHW
VLVLIFTVLSLVVECTYFSAMLFKIDQGGWVPLVIAAAFLLIMWVWHYGTLKRYEFEMHC
RVSMAWILGLGPSLGLVRVPGVGLVYTELASGVPHIFSHFITNLPAIHSVVVFVCVKNLP
VYTVPEEERFLVKRIGPKNFHMFRCVARYGYRDLHKKDDDFEKRLFESLFLYVRLESMME
GGCSDSDDYSICGSQQQLKDTLGNGNENENLATFDTFDSIESITPVKRVSNTVTASSQMS
GVDELEFINGCRDAGVVHIMGNTVVRARREARFYKKIAIDYVYAFLRKICREHSVIYNVP
QESLLNVGQIFYV

www.000webhost.com

Other information
Ka divergence:-0.174563KaKs divergence:-0.419041
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):2391Length 2 (bp):2382Length divergence:-0.002
MFE 1 (kcal):-721.51MFE 2 (kcal):-754.5MFE divergence0.022