Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31280-AT1G31290
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Argonaute family protein
Function (paralog2):ARGONAUTE 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.5678176506979
Log2 mRNA fold difference:-2.3097537014534
Log2 TE fold difference:-0.20015910482612
Sequences
Protein sequence

MERGGYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGGEQGRGRGSERGGGNRGQGRGE
QQDFRSQSQRGPPPGHGGRGTTQFQQPRPQVAPQPSQAPASYAGSVGGVAGRGAWGRKPQ
VPSDSASPSTSTTVVSEPVRVAEVMNLKPSVQVATSDRKEPMKRPDRGGVVAVRRVNLYV
NHYKVNFNPESVIRHYDVEIKGEIPTKKVSRFELAMVRDKVFTDNPDEFPLAMTAYDGQK
NIFSAVELPTGSYKVEYPKTEEMRGRSYTFTIKQVNVLKLGDLKEYMTGRSSFNPRDVLQ
GMDVVMKEHPSKCMITVGKSFFTRETEPDEDFRFGVIAAKGYRHTLKPTAQGLSLCLDYS
VLAFRKAMSVIEYLKLYFNWSDMRQFRRRDVEEELIGLKVTVNHRKNKQKLTIVGLSMQN
TKDIKFDLIDQEGNEPPRKTSIVEYFRIKYGRHIVHKDIPCLDLGKNGRQNFVPMEFCDL
VEGQIYPKDNLDKDSALWLKKLSLVNPQQRQRNIDKMIKARNGPSGGEIIGNFGLKVDTN
MTPVEGRVLKAPSLKLAERGRVVREEPNPRQNNQWNLMKKGVTRGSIVKHWAVLDFTASE
RFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHG
GARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKV
GGSNVELMDTFSFFKKEDEVMFIGADVNHPAARDKMSPSIVAVVGTLNWPEANRYAARVI
AQPHRKEEIQGFGDACLELVKAHVQATGKRPNKIVIFRDGVSDAQFDMVLNVELLDVKLT
FEKNGYNPKITVIVAQKRHQTRFFPATNNDGSDKGNVPSGTVVDTKVIHPYEYDFYLCSH
HGGIGTSKPTHYYTLWDELGFTSDQVQKLIFEMCFTFTRCTKPVSLVPPVYYADMVAFRG
RMYHEASSREKNFKQPRGASTSAASLASSLSSLTIEDKAIFKLHAELENVMFFV

MDRGGYRGGRGDGRGRGGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGGDRGR
GYSGRGDGRGRGGGGDRGRGYSGRGDGHGRGGGGDRGRGYSGRGRGFVQDRDGGWVNPGQ
SSGGHVRGRGTQLQQPPPQEVPPSSSQAQVSQGVAPGDVGQGGVGDVGRDGVGDVGRDGV
GDVGQGGVGDVGQVGVGDVGQGGVGDVGQGGVGDVGRDGVGDVGRDGVGDVGRGGVGDRG
QSQSGLSSGHFGRGTQLQQPQPQAVSQSSSQGQVSQSFATGGVGLGAWARKPQLFSDSTV
LPSSSSSNVVASHTASGSQVMTPKPSSSDKKEPVKRPDKGGNIKVKGVINLSVNHFRVSF
STESVIRHYDVDIKGENSSKKISRFELAMVKEKLFKDNNDFPNAMTAYDGQKNIFSAVEL
PTGSFKVDFSETEEIMRGRSYTFIIKQVKELKLLDLQAYIDGRSTFIPRDVLQGMDVVMK
EHPSKRMITVGKRFFSTRLEIDFGYGVGAAKGFHHTLKPTVQGLSLCLNSSLLAFRKAIS
VIEYLKLYFGWRNIRQFKNCRPDDVVQELIGLKVTVDHRKTKQKFIIMGLSKDDTKDIKF
DFIDHAGNQPPRKISIVEYFKEKYGRDIDHKDIPCLNLGKKGRENFVPMEFCNLVEGQIF
PKEKLYRDSAAWLKELSLVTPQQRLENINKMIKSSDGPRGGDIIGNFGLRVDPNMTTVEG
RVLEAPTLKLTDRRGNPIHEKLMSESNQWNLTTKGVTKGSIIKHWAVLDFTASESLKKKM
PGYFVNKLIERCKGLGMQMEAPIVCKTSSMETLYDGNALEELLRSVIDEASHNHGGACPT
LVLCAMTGKHDGYKTLKWIAETKLGLVTQCFLTISAIKGETVSDQYLANLALKINAKVGG
TNVELVDNIFSFFKKEDKVMFIGADVNHPAAHDNMSPSIVAVVGTLNWPEANRYAARVKA
QSHRKEEIQGFGETCWELIEAHSQAPEKRPNKIVIFRDGVSDGQFDMVLNVELQNVKDVF
AKVGYNPQITVIVAQKRHQTRFFPATTSKDGRAKGNVPSGTVVDTTIIHPFEYDFYLCSQ
HGAIGTSKPTHYYVLSDEIGFNSNQIQKLIFDLCFTFTRCTKPVALVPPVSYADKAASRG
RVYYEASLMKKNSKQSRGASSSSASVASSSSSVTMEDKEIFKVHAGIENFMFFV

www.000webhost.com

Other information
Ka divergence:0.187381KaKs divergence:0.180656
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):3045Length 2 (bp):3585Length divergence:0.081
MFE 1 (kcal):-1049.22MFE 2 (kcal):-1230.31MFE divergence0.079