Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31310-AT2G35640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):hydroxyproline-rich glycoprotein family protein
Function (paralog2):Homeodomain-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.50227792446326
Log2 mRNA fold difference:2.7652459954653
Log2 TE fold difference:-2.4587684778989
Sequences
Protein sequence

MADQSGGLVMMREYRKGNWTLNETMVLIEAKRMDDERRMRRSIGLPPPEQQQDIRSNKPA
ELRWKWIEDYCWRKGCMRSQNQCNDKWDNLMRDYKKVREYERRRVESSITAGESSSSSAP
AGETASYWKMEKSERKERSLPSNMLPQTYQALFEVVESKTLPSSTAVTAVTAAVAAAAAA
ISSGNGSGGGQIQKVIQQGLGFVVPKVHQIIQQQPVLLPLQPPPPPPPSQPLPRPLLLPP
PPPPSFHAQPILPTKDSSTDSDTSEYSDTSPAKRRRTMPTTTTAGPSGGGVDVEEVGRSK
RDEETTVAAALSRSVSVIANAIRESEERQDRRHKEVMNVQERRLKIEESNVEMNREGMNG
LVEAINKLASSIFALASSSRHNN

MADADPSSGEQIVMRECRKGNWTVSETLVLIEAKKMDDQRRVRRSEKQPEGRNKPAELRW
KWIEEYCWRRGCYRNQNQCNDKWDNLMRDYKKIREYERSRVESSFNTVTSSSYWKMDKTE
RKEKNLPSNMLPQIYDVLSELVDRKTLPSSSSAAAAVGNGNGGQILRVCQQSLGFVAPMM
AQPMHQIPTTIVLSLPPPPPQSLSLSLPSPPQPPPSSSFHAEPIPPTVGTSSTKRRRTTP
GETTAGGEREVEEDAVGVALSRCTSVITQVIRENEEGQERRHKEVVRLQERRLKIEESKT
EINRQGMNGLVDAINQLASSILALASSSCHNNRNHQGGPP

www.000webhost.com

Other information
Ka divergence:0.0594959KaKs divergence:-0.00867754
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1152Length 2 (bp):1023Length divergence:-0.059
MFE 1 (kcal):-371.91MFE 2 (kcal):-320.6MFE divergence-0.074