Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31340-AT2G35635
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):related to ubiquitin 1
Function (paralog2):ubiquitin 7

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.83975531116503
Log2 mRNA fold difference:0.50735261917297
Log2 TE fold difference:0.39166457384559
Sequences
Protein sequence

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGTMIKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLI
YAGKQLADDKTAKDYNIEGGSVLHLVLALRGGFGLL

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGTMIKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLI
YAGKQLADDKTAKDYAIEGGSVLHLVLALRGGLL

www.000webhost.com

Other information
Ka divergence:1KaKs divergence:0.985401
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):471Length 2 (bp):465Length divergence:-0.006
MFE 1 (kcal):-124.1MFE 2 (kcal):-121.75MFE divergence-0.01