Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31420-AT2G35620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.5967096277972
Log2 mRNA fold difference:-1.9766649661241
Log2 TE fold difference:-0.59927149909964
Sequences
Protein sequence

MMGICEMKSCCSWLLLISLLCSLSNESQAISPDGEALLSFRNAVTRSDSFIHQWRPEDPD
PCNWNGVTCDAKTKRVITLNLTYHKIMGPLPPDIGKLDHLRLLMLHNNALYGAIPTALGN
CTALEEIHLQSNYFTGPIPAEMGDLPGLQKLDMSSNTLSGPIPASLGQLKKLSNFNVSNN
FLVGQIPSDGVLSGFSKNSFIGNLNLCGKHVDVVCQDDSGNPSSHSQSGQNQKKNSGKLL
ISASATVGALLLVALMCFWGCFLYKKLGKVEIKSLAKDVGGGASIVMFHGDLPYSSKDII
KKLEMLNEEHIIGCGGFGTVYKLAMDDGKVFALKRILKLNEGFDRFFERELEILGSIKHR
YLVNLRGYCNSPTSKLLLYDYLPGGSLDEALHVERGEQLDWDSRVNIIIGAAKGLSYLHH
DCSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQS
GRATEKTDVYSFGVLVLEVLSGKRPTDASFIEKGLNVVGWLKFLISEKRPRDIVDPNCEG
MQMESLDALLSIATQCVSPSPEERPTMHRVVQLLESEVMTPCPSEFYDSSSD

MGICLMKRCCSWFLLISFLSALTNENEAISPDGEALLSFRNGVLASDGVIGLWRPEDPDP
CNWKGVTCDAKTKRVIALSLTYHKLRGPLPPELGKLDQLRLLMLHNNALYQSIPASLGNC
TALEGIYLQNNYITGTIPSEIGNLSGLKNLDLSNNNLNGAIPASLGQLKRLTKFNVSNNF
LVGKIPSDGLLARLSRDSFNGNRNLCGKQIDIVCNDSGNSTASGSPTGQGGNNPKRLLIS
ASATVGGLLLVALMCFWGCFLYKKLGRVESKSLVIDVGGGASIVMFHGDLPYASKDIIKK
LESLNEEHIIGCGGFGTVYKLSMDDGNVFALKRIVKLNEGFDRFFERELEILGSIKHRYL
VNLRGYCNSPTSKLLLYDYLPGGSLDEALHKRGEQLDWDSRVNIIIGAAKGLAYLHHDCS
PRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYMQSGRA
TEKTDVYSFGVLVLEVLSGKLPTDASFIEKGFNIVGWLNFLISENRAKEIVDLSCEGVER
ESLDALLSIATKCVSSSPDERPTMHRVVQLLESEVMTPCPSDFYDSSSD

www.000webhost.com

Other information
Ka divergence:0.202699KaKs divergence:0.0299914
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1779Length 2 (bp):1770Length divergence:-0.003
MFE 1 (kcal):-555.39MFE 2 (kcal):-553.29MFE divergence-0.002