Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31760-AT2G35605
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SWIB/MDM2 domain superfamily protein
Function (paralog2):SWIB/MDM2 domain superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.746795013714
Log2 mRNA fold difference:2.174994849303
Log2 TE fold difference:-0.40558640654264
Sequences
Protein sequence

MAGISRVLGGFRTLMSKAATVEAVTVAGEGKGIFKTRPVSQQLASFAGERELTRGSALKK
VWEYVKLHNLQNPANKKEIHCDDKLKTIFDGKDKVGITEIMKLLSPHFPKSV

MSRVFGACRVLMAKAASSTGAKTGRQGTGILKVVPVSKPLANFIGENEVSRTTAVKKIWE
YIKLNNLQNPVNKREILCDEQLKTIFSGKDTVGFLEISKLLSQHFPKSA

www.000webhost.com

Other information
Ka divergence:-0.17901KaKs divergence:-0.553802
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):339Length 2 (bp):330Length divergence:-0.013
MFE 1 (kcal):-106MFE 2 (kcal):-85.59MFE divergence-0.107