Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31820-AT1G31830
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Amino acid permease family protein
Function (paralog2):Amino acid permease family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.69270211496925
Log2 mRNA fold difference:1.6620081267426
Log2 TE fold difference:-0.89239996103727
Sequences
Protein sequence

MGDYNMNEFAYGNLYDDDDGDVGGSSKEGNNSIQKVSMLPLVFLIFYEVSGGPFGAEGSV
NAAGPLLALLGFVIFPFIWCIPEALITAEMSTMFPINGGFVVWVSSALGTFWGFQVGWMK
WLCGVIDNALYPVLFLDYLKSAVPALATGLPRVASILILTLLLTYLNYRGLTIVGWTAVF
MGVFSMLPFAVMSLVSIPQLEPSRWLVMDLGNVNWNLYLNTLLWNLNYWDSVSTLAGEVA
NPKKTLPKALCYGVIFVALSNFLPLLSGTGAIPLDRELWTDGYLAEVAKAIGGGWLQLWV
QAAAATSNMGMFLAEMSSDSFQLLGMAELGILPEIFAQRSRYGTPLLGILFSASGVLLLS
GLSFQEIIAAENLLYCGGMILEFIAFVRLRKKHPAASRPYKIPVGTVGSILICVPPIVLI
CLVIVLSTIKVALVSFVMVVIGFLMKPCLNHMDGKKWVKFSVCSDLAEFQKENLDCEESL
LR

MQKRRIITVNPSASIEMSQYENNEVPYSSVGADEVPSSPPKATDKIRKVSMLPLVFLIFY
EVSGGPFGVEDSVNAAGPLLALLGFVIFPFIWSIPEALITAEMGTMYPENGGYVVWVSSA
LGPFWGFQQGWMKWLSGVIDNALYPVLFLDYLKSGVPALGSGLPRVASILVLTILLTYLN
YRGLTIVGWVAVLMGVFSILPFAVMGLISIPQLEPSRWLVMDLGNVNWNLYLNTLFWNLN
YWDSISTLAGEVENPNHTLPKALFYGVILVACSYIFPLLAGIGAIPLEREKWTDGYFSDV
AKALGGAWLRWWVQAAAATSNMGMFIAEMSSDSFQLLGMAERGMLPEFFAKRSRYGTPLL
GILFSASGVVLLSWLSFQEIVAAENLLYCVGMILEFIAFVRMRMKHPAASRPYKIPIGTT
GSILMCIPPTILICAVVALSSLKVAAVSIVMMIIGFLIHPLLNHMDRKRWVKFSISSDLP
DLQQQTREYEETLIR

www.000webhost.com

Other information
Ka divergence:-0.386914KaKs divergence:0.184562
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1449Length 2 (bp):1488Length divergence:0.013
MFE 1 (kcal):-438.02MFE 2 (kcal):-472.7MFE divergence0.038