Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G31940-AT2G35585
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-4.0368165803468
Log2 mRNA fold difference:-2.9294854748252
Log2 TE fold difference:-1.0086030622658
Sequences
Protein sequence

MVGIFSRFSVGRSTHRRTQSAIDDKEVLAPNSDVIAATTTTATTATHGIEVATEFKPVEH
PVEPLDNDLPIQCPLPEPSILNDGRIWKERVSASMRRKGDLQIVKDEAASESDGSAPKPP
RPPQPNRSILPSLSAPEHNLLNLLEECNAMPPVTSKNG

MVGIFSRFSVVRGSHRRTQSAIDGREVLSPRSDLAPATNTTTTETHGIEVATEFKPVDHP
MEPLDNDQPIQCPLPEPSILNDGRLWKERVSASSMRRRSDLAIVQDGMDEESDVSVTSIP
SRTSQCNTNRPILPSLSAPEHDLLNLLEECKVSGSI

www.000webhost.com

Other information
Ka divergence:0.37344KaKs divergence:-0.33118
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):477Length 2 (bp):471Length divergence:-0.006
MFE 1 (kcal):-140MFE 2 (kcal):-146.36MFE divergence0.022