Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32150-AT2G35530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic region/leucine zipper transcription factor 68
Function (paralog2):basic region/leucine zipper transcription factor 16

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.47810036290843
Log2 mRNA fold difference:-0.58599049422582
Log2 TE fold difference:0.014973837395623
Sequences
Protein sequence

MGSSEMEKSGKEKEPKTTPPSTSSSAPATVVSQEPSSAVSAGVAVTQDWSGFQAYSPMPP
HGYVASSPQPHPYMWGVQHMMPPYGTPPHPYVTMYPPGGMYAHPSLPPGSYPYSPYAMPS
PNGMAEASGNTGSVIEGDGKPSDGKEKLPIKRSKGSLGSLNMIIGKNNEAGKNSGASANG
ACSKSAESGSDGSSDGSDANSQNDSGSRHNGKDGETASESGGSAHGPPRNGSNLPVNQTV
AIMPVSATGVPGPPTNLNIGMDYWSGHGNVSGAVPGVVVDGSQSQPWLQVSDEREIKRQR
RKQSNRESARRSRLRKQAECDELAQRAEVLNGENSSLRAEINKLKSQYEELLAENSSLKN
KFSSAPSLEGGDLDKNEQEPQRSTRQDVA

MASNEMEKSSKEKEPKTPPPSSTAPPSSQEPSSAVSAGMATPDWSGFQAYSPMPPPHGYV
ASSPQPHPYMWGVQHMMPPYGTPPHPYVAMYPPGGMYAHPSMPPGSYPYSPYAMPSPNGM
TEVSGNTTGGTDGDAKQSEVKEKLPIKRSRGSLGSLNMITGKNNEPGKNSGASANGAYSK
SGESASDGSSEGSDGNSQNDSGSGLDGKDAEAASENGGSANGPQNGSAGTPILPVSQTVP
IMPMTAAGVPGPPTNLNIGMDYWGAPTSAGIPGMHGKVSTPVPGVVAPGSRDGGHSQPWL
QDDRELKRQRRKQSNRESARRSRLRKQAECDELAQRAEVLNEENTNLRAEINKLKSQCEE
LTTENTSLKDQLSLFPPLEGISMDNDHQEPDTNQTGAAERKVDSYKDST

www.000webhost.com

Other information
Ka divergence:0.0495297KaKs divergence:0.999878
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1170Length 2 (bp):1230Length divergence:0.025
MFE 1 (kcal):-368.2MFE 2 (kcal):-384.02MFE divergence0.021