Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32210-AT2G35520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Defender against death (DAD family) protein
Function (paralog2):Defender against death (DAD family) protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.487974589961
Log2 mRNA fold difference:-0.88883468500839
Log2 TE fold difference:0.45458952427212
Sequences
Protein sequence

MVKSTSKDAQDLFRSLRSAYSATPTNLKIIDLYVVFAVFTALIQVVYMALVGSFPFNSFL
SGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG

MVKSTSKDAQDLFHSLHSAYTATPTNLKIIDLYVCFAVFTALIQQVAYMALVGSFPFNSF
LSGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG

www.000webhost.com

Other information
Ka divergence:-0.208811KaKs divergence:0.23212
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):348Length 2 (bp):351Length divergence:0.004
MFE 1 (kcal):-95.9MFE 2 (kcal):-89.09MFE divergence-0.037