Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32230-AT2G35510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WWE protein-protein interaction domain protein family
Function (paralog2):similar to RCD one 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.9382834156439
Log2 mRNA fold difference:-2.0485403031489
Log2 TE fold difference:0.081284756720957
Sequences
Protein sequence

MEAKIVKVLDSSRCEDGFGKKRKRAASYAAYVTGVSCAKLQNVPPPNGQCQIPDKRRRLE
GENKLSAYENRSGKALVRYYTYFKKTGIAKRVMMYENGEWNDLPEHVICAIQNELEEKSA
AIEFKLCGHSFILDFLHMQRLDMETGAKTPLAWIDNAGKCFFPEIYESDERTNYCHHKCV
EDPKQNAPHDIKLRLEIDVNGGETPRLNLEECSDESGDNMMDDVPLAQRSSNEHYDEATE
DSCSRKLEAAVSKWDETDAIVVSGAKLTGSEVLDKDAVKKMFAVGTASLGHVPVLDVGRF
SSEIAEARLALFQKQVEITKKHRGDANVRYAWLPAKREVLSAVMMQGLGVGGAFIRKSIY
GVGIHLTAADCPYFSARYCDVDENGVRYMVLCRVIMGNMELLRGDKAQFFSGGEEYDNGV
DDIESPKNYIVWNINMNTHIFPEFVVRFKLSNLPNAEGNLIAKRDNSGVTLEGPKDLPPQ
LESNQGARGSGSANSVGSSTTRPKSPWMPFPTLFAAISHKVAENDMLLINADYQQLRDKK
MTRAEFVRKLRVIVGDDLLRSTITTLQNQPKSKEIPGSIRDHEEGAGGL

MEAKIVKVSDSSYKDGLGKKRKHPGNYTPYDSGRSYAKLQWVLSPNSSTQKLEKRRNLDG
ENKVIVSENHVEKSLVRYFSYYKKTGVPKRVMFHENGEWIDLPDHILCDIRNDLEAKRAT
IEFNWCGRHFLLDFLHMYRLDLETGVKTQLAWIDIAGKCFFPETFDTLERDGCHHIRGED
PEQHDQREIKLHIEIDVNSGELPRLNLNVVTDESGDNMDDFQAVQRSSNGPNDEASEDSC
SRELDDAVEKWDKTETDRFSGVKPAEEELDKDAVKQMFALGAATLGHVESLDVYQFSSEI
AKARLSLFQKQADITKKHRGDANIRYAWVPAKKEVLSAVMMHGLGVGGAFIKKSMYGVGV
HAANCPYFSARYCDIDDNGVRHMVLCRVIMGNMEPLRGDNTQYFTGGEEYDNGVDDVESP
KHYLIWNMNMNTHIYPEFVVSFKLSIPNAEGNILPTTQSRHESSGLTLEGPKGSPSNEPG
RVSNGGSGSEKNSSSSRRPRSPIMPFPLLFKAISSKIARKDMDLIIAGYQELREKKVSRK
EFYKTLSMIVGDDDLLISTITGLQRSLG

www.000webhost.com

Other information
Ka divergence:0.188297KaKs divergence:0.766928
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1770Length 2 (bp):1707Length divergence:-0.018
MFE 1 (kcal):-545.45MFE 2 (kcal):-535.72MFE divergence-0.009