Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32260-AT2G35480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0832351087964
Log2 mRNA fold difference:-0.82235383526924
Log2 TE fold difference:-0.21489316249503
Sequences
Protein sequence

MVFWEITLGTAYFLGLRRTYRLALKIQRRLVTPKHPKIRQFLHRRTRKIFDVAISVHKNI
QERDIEVGRNLGNWILRWLDKMKPAAQIRTRPELPHNSNSNMDKAKRLTELSRPKSHTNT
TQTPQNRESDRHLFTSLKHFRHKPFPSVSMMIQPPRPNGTTTQYRHYYSGGLAASLIQPS
YVTGGGFNGVVRKDILQWMAQR

MVLWELALGTAYFLGIRRTYRLALKTQRRLVSPKHPRIRDFMHRRTYQIFDMALRVHKNI
QQRDMVIGRNLGNWILRGLDRMKPSAQVLLPKNTEPSIDKAKRVLQSTRLKPHVNTQTPQ
NREVDRNLFMSLRNFRSKYPIASMMMIKPPRSTGTTTQYRPYSVGESSLIKPIYARGGFN
SVIRKDILQWMVQKR

www.000webhost.com

Other information
Ka divergence:0.425151KaKs divergence:0.596945
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):609Length 2 (bp):588Length divergence:-0.018
MFE 1 (kcal):-163.92MFE 2 (kcal):-168.2MFE divergence0.013