Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32360-AT2G35430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc finger (CCCH-type) family protein
Function (paralog2):Zinc finger C-x8-C-x5-C-x3-H type family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.9000843228541
Log2 mRNA fold difference:-2.2389236197999
Log2 TE fold difference:0.10889608836074
Sequences
Protein sequence

MSHHRRDSGGDVVHVIPTNNPPPDNWFPNLGDSAVWATEDDYNRAWAMNPDNTSGDNNGP
PNKKTRGSPSSSSATTTSAASNRTKAIGKMFFKTKLCCKFRAGTCPYITNCNFAHTVEEL
RRPPPNWQEIVAAHEEERSGGMGTPTVSVVEIPREEFQIPSLVSSTAESGRSFKGRHCKK
FYTEEGCPYGESCTFLHDEASRNRESVAISLGPGGYGSGGGGGSGGGSVGGGGSSSNVVV
LGGGGGSGSGSGIQILKPSNWKTRICNKWEITGYCPFGAKCHFAHGAAELHRFGGGLVEE
EGKDGVSPNPDTKQTVQNPKGLSDTTTLLSPGVPHNADASYHTGVALQRASSAVTQKPGI
RTHQKWKGPAKISRIYGDWIDDIE

MSHRRDYGSDAVHVRITHDPPPENCFPNSGDSSVWATEDDYSRVWAINSDGAESPSKKTR
SSSSSEIGKSFFKTKLCFKFRAGTCPYSASSCHFAHSAEELRLPPPPPPNWQETVTEASR
NRESFAVSLGPRGNVAQTLKSPNWKTRICNKWQTTGYCPFGSHCHFAHGPSELHTFGGGL
VEGECKIGTSATLDTKQRGQVDTVTSLVSPGVSSQRTSSAVTQKPNGVRTQRKWKGPDKI
SRVYGDWIDDIE

www.000webhost.com

Other information
Ka divergence:0.378756KaKs divergence:0.596296
GC content 1 (%):47GC content 2 (%):50GC content divergence:0.031
Length 1 (bp):1155Length 2 (bp):759Length divergence:-0.207
MFE 1 (kcal):-378.29MFE 2 (kcal):-246.3MFE divergence-0.211