Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32380-AT2G35390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phosphoribosyl pyrophosphate (PRPP) synthase 2
Function (paralog2):Phosphoribosyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.723190719786
Log2 mRNA fold difference:2.1511225582426
Log2 TE fold difference:-0.40566291905487
Sequences
Protein sequence

MASLALTSPPSVKIPSYLSSSSSSLFSRSSISFRTTESRSRICVSGYAKCNLPKALNGNA
RVPIINETTIPKFFDSSRLEKSVSRNNTKLKLFSGTANPALSQEIAWYMGLELGKVSIKR
FADGEIYVQLKESVRGCDVFLVQPTCTPTNENLMELLIMVDACRRASAKKVTAVIPYFGY
ARADRKTQGRESIAAKLVANLITEAGADRVLACDLHSGQSMGYFDIPVDHVYCQPVILDY
LASKSISSEDLVVVSPDVGGVARARAFAKKLSDAPLAIVDKRRHGHNVAEVMNLIGDVKG
KVAVMVDDIIDTAGTIVKGAALLHEEGAREVYACCTHAVFSPPAIERLSSGLLQEVIVTN
TLPVAEKNYFPQLTILSVANLLGETIWRVHDDSSVSSIFL

MASLGLSFPPAAKTPTYLASSSSTFFSNSSLSVRTSQFRSRNSVFACVKCDMPESLNVGN
GNPSIPIINERTLPKFLESARMEKSVNRTNTRLKLFSGTANPALAQEIAWYMGLDLGKVN
IKRFADGEIYVQLQESVRGCDVYLVQPTCTPTNENLMELLIMVDACRRASAKKVTAVIPY
FGYARADRKTQGRESIAAKLVANLITEAGADRVLACDLHSGQSMGYFDIPVDHVYCQPVI
LDYLASKSIPSEDLVVVSPDVGGVARARAFAKKLSDAPLAIVDKRRSGHNVAEVMNLIGD
VRGKVAIMVDDMIDTAGTIVKGAALLHQEGAREVYACCTHAVFSPPAIERLSGGLLQEVI
VTNTLPVAEKNYFPQLTILSVANLLGETIWRVHDDSSVSSIFL

www.000webhost.com

Other information
Ka divergence:-0.135168KaKs divergence:0.144397
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1203Length 2 (bp):1212Length divergence:0.004
MFE 1 (kcal):-391.3MFE 2 (kcal):-370.87MFE divergence-0.027