Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32470-AT2G35370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Single hybrid motif superfamily protein
Function (paralog2):glycine decarboxylase complex H

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.80673065836846
Log2 mRNA fold difference:-0.43772864976316
Log2 TE fold difference:-0.37902302053376
Sequences
Protein sequence

MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATI
GITDHAQDHLGEVVFVELPEANSSVSKEKSFGAVESVKATSEILSPISGEVIEVNTKLTE
SPGLINSSPYEDGWMIKVKPSSPAELEALMGPKEYTKFCEEEDAAH

MALRMWASSTANALKLSSSVSKSHLSPFSFSRCFSTVLEGLKYANSHEWVKHEGSVATIG
ITAHAQDHLGEVVFVELPEDNTSVSKEKSFGAVESVKATSEILSPISGEIIEVNKKLTES
PGLINSSPYEDGWMIKVKPSSPAELESLMGPKEYTKFCEEEDAAH

www.000webhost.com

Other information
Ka divergence:-0.298163KaKs divergence:-0.567164
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):501Length 2 (bp):498Length divergence:-0.003
MFE 1 (kcal):-154.4MFE 2 (kcal):-155.23MFE divergence0.003