Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32490-AT2G35340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA helicase family protein
Function (paralog2):helicase domain-containing protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.6584562988343
Log2 mRNA fold difference:-3.231455095264
Log2 TE fold difference:1.6980963877592
Sequences
Protein sequence

MASNDLKTWVSDKLMMLLGYSQAAVVNYLIAMAKKTKSPTELVGELVDYGFSSSGDTRSF
AEEIFARVPRKTAGVNLYQKHEAEAAMLVRKQKTYALLDADDDEDEVVVEKKSSVSESRK
SDKGKKRFRKKSGQSDESDGEVAVREDSRHVRRKVSEEDDGSESEEERVRDQKEREELEQ
HLKDRDTARTRKLTEQTLSKKEKEEAVRRANALEKDDLYSLRKVSRQEYLKKREQKKLDE
LRDEIEDEQYLFGGEKLTETELREFRYKKELYDLVKKRTQDEDNVEEYRIPDAYDQEGGV
DQEKRFSVAVQRYRDLDSTEKMNPFAEQEAWEDHQIGKATLKFGAKNKQASDDYQFVFED
QINFIKESVMAGENYEDAMDAKQKSQDLAEKTALEELQEVRRSLPIYTYRDQLLKAVEEH
QVLVIVGDTGSGKTTQIPQYLHEAGYTKRGKVGCTQPRRVAAMSVAARVAQEMGVKLGHE
VGYSIRFEDCTSDKTVLKYMTDGMLLRELLGEPDLASYSVVIVDEAHERTLSTDILFGLV
KDIARFRPDLKLLISSATMDAEKFSDYFDTAPIFSFPGRRYPVEINYTSAPEADYMDAAI
VTILTIHVREPLGDILVFFTGQEEIETAEEILKHRIRGLGTKIRELIICPIYANLPSELQ
AKIFEPTPEGARKVVLATNIAETSLTIDGIKYVVDPGFSKMKSYNPRTGMESLLITPISK
ASATQRAGRAGRTSPGKCYRLYTAFNYNNDLEENTVPEVQRTNLASVVLALKSLGIHDLI
NFDFMDPPPAEALVKSLELLFALGALNKLGELTKAGRRMAEFPLDPMLSKMIVVSDKYKC
SDEIISIAAMLSIGGSIFYRPKDKQVHADNARMNFHTGNVGDHIALLKVYSSWKETNFST
QWCYENYIQVRSMKRARDIRDQLEGLLERVEIDISSNLNELDSVRKSIVAGFFPHTAKLQ
KNGSYRTVKHPQTVHIHPNSGLSQVLPRWVVYHELVLTSKEYMRQVTELKPEWLIELAPH
YYQLKDVEDAASKKMPKGAGKAAM

MGSNDLNTWVSDKLMVLLGFSQTAVVQYLIAMAKQSKSPGELVRELVECGFSLSGDTRAF
AEEIYARAPRKTPGVNLYQQQEAEAAMLLKKQKTFSLLEADHDEDENNVKKQSASKTGKS
DKGQKRFRKKSEQLEDDDDEVVIVREDKRNVRRKVSEDEDDGTESEEERLRDQREREELE
QHLRERDTARTRKLTEPKMSKKEQEEFVRRDSAVDKGDIESLRKFSWQEYMKKRKQKKVL
ELKDDIEDEPYLFGDEKLTEREIREFRYKREIYELIKKSTQEEDNVGEYRMPDAYDQQGS
VDQEKRFAVSVQRYRDMGSAEKMNPFAEQEAWEDHQIENAALKFGAKNKEVSDNYEFVFE
DQIDFIKASVLAGDNYEDEMHAKPSQDSAGKSAFHMLQEDRKALPIYTYRDQLLNAVKDH
QVLIIVGETGSGKTTQIPQYLHEAGYTKLGKVGCTQPRRVAAMSVAARVAQEMGGKLGHE
VGYSIRFEDCTSEKTILKYMTDGMLLRELLGEPDLGSYSVIIVDEAHERTLRTDILFGLV
KDIARARPDLKLLISSATMDAEKFSDFFDQAPIFRFPGRRYPVDICFTTAPEADYMDAAI
TTVLTIHVKEPLGDVLVFLPGQEEIEAVEENLKHKIRGLGTKIRELIICPIYANLPSELQ
AKIFEPTPEGARKVVLATNIAETSLTIDGIKYVVDPGFSKMKSYNPRTGMESLLVTPISK
ASATQRTGRAGRTSPGKCYRLYTAFNYYNDLEDNTVPEIQRTNLASVVLSLKSLGIHNLL
NFDFMDPPPSEALIKSLELLFALGALNQLGELTKAGRRMAEFPLDPMLSKMIVVSDKYKC
SDEIISIAAMLSIGPSIFYRPKDKQVHADNAMKNFHVGNVGDHIAFLKIYNSWKETNYST
QWCYENYIQVRSMKRARDIRDQLEGLLERVEIDVSSNANELDSIRKSIVAGFFPHTAKLQ
KNGSYRTVKHPQTVHIHPASGLSQVLPRWVVYHQLVLTSKEYMRQVTELKPEWLIEIAPH
YYQLKDVEDATSKKMPKTSGRAVV

www.000webhost.com

Other information
Ka divergence:0.064002KaKs divergence:-0.932101
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):3135Length 2 (bp):3135Length divergence:0
MFE 1 (kcal):-900.94MFE 2 (kcal):-914.16MFE divergence0.007