Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32530-AT2G35330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.6475459261308
Log2 mRNA fold difference:0.67316024568541
Log2 TE fold difference:0.12598486252277
Sequences
Protein sequence

MGCTVREKHVKPTRRIKAAAFRSDPPLCWVEKIAMSQSIVENLVYHPGLTDSGSVNLNSV
TENPEENFWAYCTEEHLEEILLKHLEFLYNQAVSKLLELGYEERVALKAVLSNGHCYGEL
DVLTNIVNNSLSYLNSGGGGGGSNGNGEDRTETGFTDLRDLEEYSLAGMIYLLQQVKPNL
SKGDAMWCLLMSELHVGRASTLDVPTNRSSCCTKEDSNVEDVGTGGTLDIAGFMAPALCR
FHGGWGFGNGGGPEFSGNGFSMKGAELKLQREIDCPKRFNLSPSMKSLLKRNVAAFAAGY
RASMKQKQIQSSDTIGDSKACNDPAIVKSCGQQPRKSGSEESVSTVLEKFRDLNLDDNLE
SVGVDDKDCVIVDLLHQVKDFEKKVKERKEWAQKNAMQAAQKVSEELAELKTLSSEREGI
QLLKKGKQAVEESTAKRFTDKEIELRKACSQNDRANVIVRKLENQNAEIRAEREGSKLSA
SESLKACMEASKKEKKCLKKLVAWEKQILKLQDEITAEKEKIKALYKTLAQITEYEKEIE
AKWRQEQKAKEEALAQMEEEQRSKEAAEGHNKRKLETLRLKIELDFQRHKDDHQRLEQEL
GRLKASSDSDSSHISNNAWKPKKSQGENIAKLLEEIDKLEGSYDNEANYDRECIICMKDE
VSVVFLPCAHQVVCGSCSDSFFASNNGGSKVTCPCCRGLVQQRIRIFGATS

MIFTLSISVEFFFSFRFSYIHRRALTLMGCTVREKHVRPNRKTRSVKPEFDPCCLLDRTA
LSKSIVESSLKHLVYHPGLLDSCPESNPSGSFEDNNGWGYCTEEQLEDILLKHLEYLYNE
AISKLVGSGYDEDVALRAVLSNGYCYGGMDVMTNILHNSLAYLKSNTGEGSNVNNEDQSE
TVFTDLRQLEEYSLAGMVYLLQQVKPNLSKGDAMWCLLMSELHVGRASTMDIPSSGKGDS
SNVGVGGASSTVNGVGGAIAPALCRFHGGWGFGNGKGPKFSGNGFSLHSEELTLQREIDC
PRRFNLSPSMKSLLRENVAAFAAGYRASMEQKKQVQMQSETSGTSLSCTAAATHSEKCEQ
PHVFGSEECFSSVLEKFRDLNLDDNVDSAPEELKDDALIGLLQQVQDLKKQLKERKDWAQ
KKAMQAAQKVSDELSELKSLRSEREEIQRVKKGKQTREDSTLKKLSEMENALRKASGQVD
KANAVVRALENESAEIRAEMEASKLSASESLTACMEASKKEKKCLKKLLAWEKQKMKLQD
EITAEKEKIKALNRALAQITQEEKEYEAKWRQEQKAKEQVLAQVEEEQRSKEAIEASNKR
KVESLRLKIEIDFQRHKDDLQRLEQELSRLNKASSTDSSLQSNNTSHTKVKSDKSKGETM
SKLLEELNRLDGSYEKEANYDRECLICMKDEVSVVFLPCAHQVVCASCSDSFMGSGKATC
PCCRAPVQQRIRVFGASS

www.000webhost.com

Other information
Ka divergence:-0.236199KaKs divergence:-0.569065
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):2136Length 2 (bp):2217Length divergence:0.019
MFE 1 (kcal):-598.48MFE 2 (kcal):-682.02MFE divergence0.065