Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32610-AT2G35230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):hydroxyproline-rich glycoprotein family protein
Function (paralog2):VQ motif-containing protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.5769213073382
Log2 mRNA fold difference:0.68302872022924
Log2 TE fold difference:1.6851171132605
Sequences
Protein sequence

MDRTCWYYDQLGVNKIGKNIKKSPLPQPQGYSMSNNDFTSIVQQLTDSPSRESLPQPLPR
NLLKPQQKIRPVGQIQINRPCVPPPVMAQPTHEFVARPPMHPLPHGSQPIISHGDQFGSN
TAESSVSVYMRYRQSSLGDSGPNENQMQPSHDNQQQPQVEGQAQSHNHHSPRFNDSARNT
PILPTPKFDGPPQQMHNNSLPSPRFNGRGILPTPTSQYRPQSPTAYRNLLSPRSPSPLLS
TGVQYPPPLTPRNYTFSSMDQPGILGPGTIPLPHASPFGVIPISSQRWRGY

MDRPRQNDHLGVNRIGKNIRKSPLHQSTFAASTSNGAAPRLQTQPQVYNISKNDFRSIVQ
QLTGSPSRESLPRPPQNNSLRPQNTRLQRIRPSPLTQLNRPAVPLPSMAPPQSHPQFARQ
PPHQPPFPQTTQQPMMGHRDQFWSNTAESPVSEYMRYLQSSLGDSGPNANQMQPGHEQRP
YIPGHEQRPYVPGNEQQPYMPGNEQRPYIPGHEQRSYMPAQSQSQSQPQPQPQPQQHMMP
GPQPRMNMQGPLQPNQYLPPPGLVPSPVPHNLPSPRFNAPVPVTPTQPSPMFSQMYGGFP
SPRYNGFGPLQSPTSQFLQPSPTGYPNMFSPRSPYPLLSPGVQYPQPLTPNFSFSQIAQQ
GSLGPGAGPSQGPPQPPPSPGLMFPLSPSGFFPMPSPRWNDY

www.000webhost.com

Other information
Ka divergence:-0.190129KaKs divergence:-0.266359
GC content 1 (%):45GC content 2 (%):49GC content divergence:0.043
Length 1 (bp):876Length 2 (bp):1209Length divergence:0.16
MFE 1 (kcal):-223.8MFE 2 (kcal):-306.82MFE divergence0.156