Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32690-AT2G35200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-4.2421670943676
Log2 mRNA fold difference:-4.2063739013567
Log2 TE fold difference:0.044202151287329
Sequences
Protein sequence

MDEDGFSQCSKHFSKRGYFSGGGVCPFCLHERLSSLCPDCAHDLPCSCSSRAAVSFSPSS
SSSSSSFSIFAGDISFNISGVGSVGRVASLIECEPAFRRSKSMAIPIKPDSVIDSGLDHG
RSKKTSSFWRIFMGNRGDTKPAIMKKSRSVAVAGEFGFSPVPVPATGKGKGWNFPSPIKV
FRQSRVSKMIFQQRSPLYRG

MQREKTQTNLRLDEGGGSVWQKCSRHEGRFVCVAGVCPYCLHERLSSLCPDCAHDLPCSC
TPRASVSSRGEGDVSFARIGSVGRVANLIECEPAFRRSTSITGPYFWSAKPEPILETEKD
LKPGRGRWLWRLFRGNREEETKIKAAKVMKKSNSVAGEVLFSPTPVTSKGNGWYFPSPIK
VFRQSRVSKMIFQQRSPLYRG

www.000webhost.com

Other information
Ka divergence:0.327867KaKs divergence:-0.0843491
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):603Length 2 (bp):606Length divergence:0.002
MFE 1 (kcal):-197.8MFE 2 (kcal):-191.94MFE divergence-0.015