Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32760-AT4G10630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glutaredoxin family protein
Function (paralog2):Glutaredoxin family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.37135236037263
Log2 mRNA fold difference:-0.94071713825403
Log2 TE fold difference:1.3522955070945
Sequences
Protein sequence

MGGCVSSNLLTPTDDSSFSHLTSSSLSQHFVKLTSTTYGLLNLDSSSPSPPSPSSSSSAK
SVITPMTPPERFTINGKEAAMMMVKSEPTTEVINFWELMSGLDGDTCRFSPIPVKCNGFS
GGLKKENSDPNLKNPNDYEVLKPLDPKLAEESERLCDGGENRVVIYTTSLRGVRRTFEAC
NAVRAAIESFGVVVCERDVSMDRGFREELSNLMAVESTAAVLPPRVFVKGKYIGGAEEVM
RLVEEGLLGELLKEIPRKKDRCGGGCGGCGGLAFLPCSGCNGSCKVVEGWGNDAVVVKCK
ECNENGLVRCPICS

MGCVSSNLLNHDEDFSQIGGGSSAFGHHIVKLTSTTYGLLTLDPPPPPSPPMTPPEKFTV
DTKSKSIWSEPRVIKSEPEIINSWELMSGLDGESFRFTPLPKTPVKYKVFGGENKENSDP
SRRNPRKNLNDEVLKPLDLNREDSDSNSRSPRKSFKPLDLKLDEKFERICPPGGENRVVM
YTTSLRGVRQTFEACNAVRAAVESFGVVVCERDVSMDRRFREELVSLMAKRVGDEGVAAL
PPRVFVKGRYIGGGEEVLRLVEEGSFGELISGIPRKKAGGCESGACDGCGGLFFLPCFRC
NGSCKMVKGWGSASVVVRCNECNENGLVPCPICS

www.000webhost.com

Other information
Ka divergence:-0.279282KaKs divergence:-0.243383
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):945Length 2 (bp):1005Length divergence:0.031
MFE 1 (kcal):-333.2MFE 2 (kcal):-329.71MFE divergence-0.005