Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32790-AT4G10610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CTC-interacting domain 11
Function (paralog2):CTC-interacting domain 12

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.53464217181511
Log2 mRNA fold difference:-1.077229166485
Log2 TE fold difference:0.50684084490076
Sequences
Protein sequence

MAVVETGAAATAADAGGVVIQPPPSSPPSSMTSQDSGVSSDDQNHHSRIDQVLRHDQGLY
SKIGSHVARSDGVDGGESFKRDMRELQELFSKLNPMAEEFVPPSLNKQGGNGVNGGFFTS
AGSFFRNNGFAGTGNGGYGNENGGFRRKKSFGQGKRRMNARTSMAQREDVIRRTVYVSDL
DQQVTEEQLAGLFVSCGQVVDCRICGDPNSVLRFAFIEFTDEEGAMTALNLSGTMLGFYP
VKVLPSKTAIAPVNPTFLPRTEDEREMCARTIYCTNIDKKVTQSDVKIFFESFCGEVYRL
RLLGDYQHSTRIAFVEFVMAESAIAALNCSGVVLGSLPIRSSFKDACSSEITEASNALIL
ALQVFTYLMSPQYIYRCVVLKTALHRHVKMFVCISHLLFSKCNSGI

MAVIESVGANTTVEAGGLISPSPPSSVTSQESGASSNNDHGGNGIHDEIGVHVARSDGGE
SFKRDMRELHELLSKLNPMAKEFIPPSLTKPVVNGFNGGFFAVNNGFVAAGNFPVNEDGS
FRRKKSFGQQGKRRMNPRTSLAQREEIIRRTVYVSDIDQQVTEEQLAGLFIGFGQVVDCR
ICGDPNSVLRFAFIEFTDEVGARTALNLSGTMLGFYPVKVMPSKTAIAPVNPTFLPRTED
EREMCARTIYCTNIDKKLTQTDIKLFFESVCGEVYRLRLLGDYHHPTRIGFVEFVMAESA
IAALNCSGVLLGSLPIRVSPSKTPVRSRAIPRHQMH

www.000webhost.com

Other information
Ka divergence:-0.138214KaKs divergence:-0.154791
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1221Length 2 (bp):1011Length divergence:-0.094
MFE 1 (kcal):-399.9MFE 2 (kcal):-329.7MFE divergence-0.096