Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32920-AT1G32928
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.7215983195813
Log2 mRNA fold difference:-0.18820460557587
Log2 TE fold difference:-1.3364036797325
Sequences
Protein sequence

MNSMFSAFDALFAEVMGKNLMASSFTATTATTKPAAAPQTQTQEKANASSKKIGLVQKIP
RFALELDGLHCFETIVRS

MNSMFSAFDAMCAEIMGKKVTAASYVYRSERNSASSSSSVGGQNASLSLKKDEKASKNMD
LPTKTPRFALELDGLHCFETIVRS

Other information
Ka divergence:-0.135466KaKs divergence:-0.0327654
GC content 1 (%):48GC content 2 (%):44GC content divergence:-0.043
Length 1 (bp):237Length 2 (bp):255Length divergence:0.037
MFE 1 (kcal):-67MFE 2 (kcal):-60.2MFE divergence-0.053