Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G32940-AT4G10550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Subtilase family protein
Function (paralog2):Subtilase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.7173551611082
Log2 mRNA fold difference:-1.3798083102385
Log2 TE fold difference:-0.34704799877848
Sequences
Protein sequence

MRNCRVLLVLVLSLVIVLNVVRASDESKVHIVYLGEKQHDDPEFVSESHHQMLSSLLGSK
VDAHESMVYSYRHGFSGFAAKLTESQAKKLADSPEVVHVMADSFYELATTRTWDYLGLSV
ANPNNLLNDTNMGDQVIIGFIDTGVWPESESFNDNGVGPIPSHWKGGCESGEKFISTNCN
RKLIGAKYFINGFLAENEGFNTTESRDYISARDFIGHGTHTASIAGGSFVPNISYKGLAG
GNLRGGAPRARIAIYKACWYVDQLGAVACSSSDILKAMDESMHDGVDVLSLSLGAQIPLY
PETDLRDRIATGAFHAVAKGIIVVCAGGNSGPAAQTVLNTAPWIITVAATTLDRSFPTPI
TLGNRKVILGQALYTGQELGFTSLVYPENAGFTNETFSGVCERLNLNPNRTMAGKVVLCF
TTNTLFTAVSRAASYVKAAGGLGVIIARNPGYNLTPCRDDFPCVAIDYELGTDVLLYIRS
TRSPVVKIQPSRTLVGQPVGTKVATFSSRGPNSISPAILKPDIGAPGVSILAATSPDSNS
SVGGFDILAGTSMAAPVVAGVVALLKALHPNWSPAAFRSAIVTTAWRTDPFGEQIFAEGS
SRKVADPFDYGGGIVNPEKAADPGLIYDMGPRDYILYLCSAGYNDSSITQLVGNVTVCST
PKTSVLDVNLPSITIPDLKDEVTLTRTVTNVGTVDSVYKVVVEPPLGIQVVVAPETLVFN
SKTKNVSFTVRVSTTHKINTGFYFGNLIWTDSMHNVTIPVSVRTQILQNYYDEN

MKLRLQNPISPALKFTGHLPPSKALKSSKETIFLTKERSFVAESSAKRKVHIVYLGEKQH
DDPEFVTESHHRMLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQAKKIADLPDVVHV
IPDSFYKLATTRTWDYLGLSAANPKSLLHETNMGEQIIIGVIDTGVWPESEVFNDSGFGP
VPSHWKGGCETGENFNSSNCNKKLIGAKYFINGFLAENESFNSTNSLDFISPRDLDGHGT
HVSTIAGGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWYLDDDDTTTCSSADILKAMD
EAMHDGVDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKGITVVCSGGNSGPDSLTVTN
TAPWIITVAATTLDRSFATPLTLGNNKVILGQAMYTGPGLGFTSLVYPENPGNSNESFSG
TCEELLFNSNRTMEGKVVLCFTTSPYGGAVLSAARYVKRAGGLGVIIARHPGYAIQPCLD
DFPCVAVDWELGTDILLYTRSSGSPVVKIQPSKTLVGQPVGTKVATFSSRGPNSIAPAIL
KPDIAAPGVSILAATTNTTFSDQGFIMLSGTSMAAPAISGVAALLKALHRDWSPAAIRSA
IVTTAWKTDPFGEQIFAEGSPPKLADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCS
VGYNETSISQLIGKTTVCSNPKPSVLDFNLPSITIPNLKDEVTITRTVTNVGPLNSVYRV
TVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPL
SVRTQILQNYYDEN

www.000webhost.com

Other information
Ka divergence:0.132251KaKs divergence:0.2172
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2325Length 2 (bp):2385Length divergence:0.013
MFE 1 (kcal):-739.63MFE 2 (kcal):-746.45MFE divergence0.005