Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33080-AT1G33090
Species:Arabidopsis
Duplication type:TD
Function (paralog1):MATE efflux family protein
Function (paralog2):MATE efflux family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.023112613141698
Log2 mRNA fold difference:-0.11785346582902
Log2 TE fold difference:0.1857304112467
Sequences
Protein sequence

MARREGEVTETLLKKSTENRGEDRDGLGMKEKVWRESKKLWVVAGPAIFTRFSTSGLSLI
SQAFIGHLGSTELAAYSITLTVLLRFSNGILLGMASALETLCGQAYGAKQYHMLGIYLQR
SWIVLTGCTICLMPIYIFAGPILLALGQEERLVRVARIIALWVIGINISFVPSFTCQMFL
QAQSKNKIIAYVAAVSLGVHVFLSWLLVVHFDFGIAGAMTSSLVAHWLPNIAQVLFVTCG
GCTETWRGFSWLAFKDLWPVFKLSVSSGGMICLELWYNSILILLTGNLKNAEVALNALAI
CININALEMMVAFGFMAAASVRVSNEIGSGNSNGAKFATMVVVSTSLSIGIIFFFIFLFL
RERVSYIFTTSEAVATQVADLSPLLAFSILLNSIQPVLSGVAVGAGWQKYVTVVNLACYY
LVGIPSGLFLGYVVGLQVKGVWLGMIFGIFVQTCVLTVMTMRTDWDQQVSSSLKRLNRWV
EPESPSRNQTLQNE

MAGEGGELTAALLKKTTENGGEENDELGLKEKVWIESKKLWVVAAPSIFTKFSTYGVSLV
TQGFVGHIGPTELAAYSITFTVLLRFSNGILLGMASALGTLCGQAYGAKQYHMLGIHLQR
SWIVLTGCTICIMPIFIFSGPILLALGQEDHIVRVARVIALWLIAINFTFVPAFTCQIFL
QSQSKNKIIAYVSAVTLGLHVFFSWLLVVHFNFGITGAMTSTLVAFWMPNIVQLLYVTSG
GCKDTWRGFTMLAFKDLWPVFKLSLSSGGMVCLELWYNSILVLLTGNLKNAEVAIDALAI
CINVNALQMMIALGFLAAVSVRVSNELGRGNPEGAKFATIVAVFTSLSIGLVLFFVFLFL
RGRISYIFTTSEAVAAEVADLSPLLAFSILLNSVQPVLSGVAVGAGWQGYVAYINLACYY
LLGIPVGLVLGYVVGLQVKGVWIGMLFGIFVQTCVLTIMTLRTDWDQQVSTSLKNINRWV
VPESRDANQISSEE

www.000webhost.com

Other information
Ka divergence:-0.056024KaKs divergence:-0.999781
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1485Length 2 (bp):1485Length divergence:0
MFE 1 (kcal):-468.41MFE 2 (kcal):-464.36MFE divergence-0.004